Comparing 206463 MicrobesOnline__882:206463 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8bj3A Crystal structure of medicago truncatula histidinol-phosphate aminotransferase (hisn6) in complex with histidinol-phosphate (see paper)
33% identity, 93% coverage: 12:357/373 of query aligns to 4:347/360 of 8bj3A
4r5zA Crystal structure of rv3772 encoded aminotransferase (see paper)
33% identity, 94% coverage: 12:363/373 of query aligns to 5:343/353 of 4r5zA
4r2nA Crystal structure of rv3772 in complex with its substrate (see paper)
33% identity, 94% coverage: 12:363/373 of query aligns to 5:343/353 of 4r2nA
3cq5B Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp (see paper)
33% identity, 88% coverage: 41:370/373 of query aligns to 30:362/366 of 3cq5B
3cq6A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound ) (see paper)
33% identity, 88% coverage: 41:370/373 of query aligns to 28:360/364 of 3cq6A
Sites not aligning to the query:
1fg7A Crystal structure of l-histidinol phosphate aminotransferase with pyridoxal-5'-phosphate (see paper)
29% identity, 96% coverage: 10:367/373 of query aligns to 6:350/354 of 1fg7A
1fg3A Crystal structure of l-histidinol phosphate aminotransferase complexed with l-histidinol (see paper)
29% identity, 96% coverage: 10:367/373 of query aligns to 6:350/354 of 1fg3A
1geyA Crystal structure of histidinol-phosphate aminotransferase complexed with n-(5'-phosphopyridoxyl)-l-glutamate (see paper)
30% identity, 87% coverage: 41:365/373 of query aligns to 16:334/335 of 1geyA
1lc8A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with its reaction intermediate (see paper)
32% identity, 93% coverage: 23:370/373 of query aligns to 12:351/356 of 1lc8A
Sites not aligning to the query:
1lkcA Crystal structure of l-threonine-o-3-phosphate decarboxylase from salmonella enterica (see paper)
32% identity, 93% coverage: 23:370/373 of query aligns to 11:350/355 of 1lkcA
Sites not aligning to the query:
1lc7A Crystal structure of l-threonine-o-3-phosphate decarboxylase from s. Enterica complexed with a substrate (see paper)
32% identity, 93% coverage: 23:370/373 of query aligns to 15:354/358 of 1lc7A
Sites not aligning to the query:
P97084 Threonine-phosphate decarboxylase; L-threonine-O-3-phosphate decarboxylase; EC 4.1.1.81 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 93% coverage: 23:370/373 of query aligns to 18:357/364 of P97084
Sites not aligning to the query:
7szpA Crystal structure of histidinol-phosphate aminotransferase from klebsiella pneumoniae subsp. Pneumoniae (strain hs11286)
28% identity, 97% coverage: 6:365/373 of query aligns to 2:348/353 of 7szpA
4r8dA Crystal structure of rv1600 encoded aminotransferase in complex with plp-mes from mycobacterium tuberculosis
32% identity, 89% coverage: 37:369/373 of query aligns to 26:361/369 of 4r8dA
2f8jA Crystal structure of histidinol-phosphate aminotransferase (ec 2.6.1.9) (imidazole acetol-phosphate transferase) (tm1040) from thermotoga maritima at 2.40 a resolution
29% identity, 86% coverage: 39:359/373 of query aligns to 21:325/335 of 2f8jA
Q9X0D0 Histidinol-phosphate aminotransferase; Imidazole acetol-phosphate transaminase; EC 2.6.1.9 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
29% identity, 86% coverage: 39:359/373 of query aligns to 20:324/335 of Q9X0D0
1uu0A Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 86% coverage: 39:359/373 of query aligns to 14:318/328 of 1uu0A
1uu1A Complex of histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form) (see paper)
29% identity, 86% coverage: 39:359/373 of query aligns to 15:319/329 of 1uu1A
1h1cA Histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (see paper)
29% identity, 86% coverage: 39:359/373 of query aligns to 15:319/329 of 1h1cA
3ly1D Crystal structure of putative histidinol-phosphate aminotransferase (yp_050345.1) from erwinia carotovora atroseptica scri1043 at 1.80 a resolution
25% identity, 88% coverage: 41:368/373 of query aligns to 19:347/354 of 3ly1D
>206463 MicrobesOnline__882:206463
MTAPSMSRPDDVRPEVLDFKPYVPGLSIDEIRDRFGLADVVKLASNENPLGTSPVVQRTL
KTKADLAFRYAQSGNPRLTRAIAAHHGVAPERVVAGNGSDEIIDLLIRVRATPGKHNIVA
FRPCFSIYELQAKFCGLEFRQADLRPDFTFDWDAFLAATDENTAIAFVTTPDNPSGWCPP
VSELEHVARTLPPSCLFVIDEAYMDFCGDEAAHSLLSRLDAFPNIAVLRTFSKSFGLAGL
RLGYGILPERLADYLHRVRLPFSVNILAEEAGLAALEDTVFRSETLRVTAEGRAYIAEGL
TALGCEVMPSWANFIMFRPPTDATDLFEALLRRGIIIRPLKSYGLPQHLRVSVGNADENR
RFIEACKEILPHA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory