SitesBLAST
Comparing 206471 MicrobesOnline__882:206471 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16171 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Bacillus cereus (see paper)
34% identity, 93% coverage: 2:446/480 of query aligns to 167:610/631 of P16171
- Y264 (≠ S101) mutation to F: 30-fold decrease in activity. 300-fold decrease in activity; when associated with F-605.
- Y605 (= Y441) mutation to F: 10-fold decrease in activity. 300-fold decrease in activity; when associated with F-264.; mutation to H: 2-fold decrease in activity.
D9J041 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Lysinibacillus sphaericus (Bacillus sphaericus) (see paper)
35% identity, 92% coverage: 4:446/480 of query aligns to 84:525/546 of D9J041
- C122 (= C43) modified: Disulfide link with 127, Redox-active
- C127 (= C48) modified: Disulfide link with 122, Redox-active
5x1yB Structure of mercuric reductase from lysinibacillus sphaericus (see paper)
35% identity, 92% coverage: 4:446/480 of query aligns to 3:444/454 of 5x1yB
- active site: A13 (= A14), V37 (≠ L39), C41 (= C43), C46 (= C48), S49 (= S51), A74 (≠ L77), G75 (≠ P78), Y178 (≠ P181), E182 (= E185), A318 (≠ G320), A437 (≠ M439), Y439 (= Y441), E444 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G12 (= G13), I32 (≠ A33), E33 (≠ D34), R34 (= R35), G39 (= G41), T40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K50 (= K52), A114 (= A117), T138 (= T141), G139 (= G142), Y178 (≠ P181), R266 (= R269), G305 (= G307), D306 (= D308), F313 (= F315), V314 (≠ T316), A317 (= A319)
P11959 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate complex; EC 1.8.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
34% identity, 94% coverage: 4:452/480 of query aligns to 9:457/470 of P11959
- 39:47 (vs. 34:43, 50% identical) binding
- K56 (= K52) binding
- D314 (= D308) binding
- A322 (≠ T316) binding
1ebdA Dihydrolipoamide dehydrogenase complexed with the binding domain of the dihydrolipoamide acetylase (see paper)
34% identity, 94% coverage: 4:452/480 of query aligns to 3:451/455 of 1ebdA
- active site: P13 (≠ A14), L37 (= L39), C41 (= C43), C46 (= C48), S49 (= S51), N74 (≠ A76), V75 (≠ L77), Y180 (≠ P181), E184 (= E185), S320 (≠ G320), H438 (≠ M439), H440 (≠ Y441), E445 (= E446)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), P13 (≠ A14), V32 (≠ A33), E33 (≠ D34), K34 (≠ R35), G39 (= G41), V40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K50 (= K52), E112 (≠ D116), A113 (= A117), T141 (= T141), G142 (= G142), Y180 (≠ P181), I181 (= I182), R268 (= R269), D308 (= D308), A314 (≠ Q314), L315 (≠ F315), A316 (≠ T316)
P00392 Mercuric reductase; Hg(II) reductase; EC 1.16.1.1 from Pseudomonas aeruginosa (see 2 papers)
36% identity, 96% coverage: 9:470/480 of query aligns to 103:558/561 of P00392
- A110 (≠ G16) binding
- G130 (= G36) binding
- T135 (≠ D42) binding
- C136 (= C43) modified: Disulfide link with 141, Redox-active
- C141 (= C48) modified: Disulfide link with 136, Redox-active
- K145 (= K52) binding
- A211 (= A117) binding
- D403 (= D308) binding
- V411 (≠ T316) binding
- C558 (= C470) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 559 binding
4k8dA Crystal structure of the c558(464)a/c559(465)a double mutant of tn501 mera in complex with NADPH and hg2+
37% identity, 91% coverage: 9:446/480 of query aligns to 8:445/466 of 4k8dA
- active site: G13 (≠ A14), I37 (≠ L39), C41 (= C43), C46 (= C48), S49 (= S51), V75 (≠ L77), P76 (= P78), V185 (≠ P181), E189 (= E185), A320 (≠ G320), F438 (≠ M439), Y440 (= Y441), E445 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), A14 (= A15), E33 (≠ D34), R34 (= R35), G39 (= G41), T40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K50 (= K52), E115 (≠ D116), A116 (= A117), T145 (= T141), G146 (= G142), R268 (= R269), G307 (= G307), D308 (= D308), F315 (= F315), V316 (≠ T316), Y317 (≠ H317)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S183 (≠ G179), S184 (≠ G180), V185 (≠ P181), V186 (≠ I182), E189 (= E185), R206 (= R202), N207 (≠ G203), R212 (= R209), T266 (≠ L267), G267 (= G268), Q314 (= Q314), F315 (= F315), V345 (≠ C346)
Sites not aligning to the query:
4k7zA Crystal structure of the c136(42)a/c141(47)a double mutant of tn501 mera in complex with NADP and hg2+
35% identity, 98% coverage: 1:470/480 of query aligns to 1:464/467 of 4k7zA
- active site: G14 (≠ A14), I38 (≠ L39), A42 (≠ C43), A47 (≠ C48), S50 (= S51), V76 (≠ L77), P77 (= P78), V186 (≠ P181), E190 (= E185), A321 (≠ G320), F439 (≠ M439), Y441 (= Y441), E446 (≠ A452), C464 (= C470)
- binding flavin-adenine dinucleotide: I10 (= I10), G11 (= G11), G13 (= G13), A15 (= A15), E34 (≠ D34), R35 (= R35), G40 (= G41), T41 (≠ D42), A42 (≠ C43), G46 (= G47), A47 (≠ C48), K51 (= K52), E116 (≠ D116), A117 (= A117), T146 (= T141), G147 (= G142), R269 (= R269), G308 (= G307), D309 (= D308), Q315 (= Q314), F316 (= F315), V317 (≠ T316), Y318 (≠ H317)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S184 (≠ G179), S185 (≠ G180), V186 (≠ P181), V187 (≠ I182), E190 (= E185), R207 (= R202), N208 (≠ G203), R213 (= R209), T267 (≠ L267), G268 (= G268), R269 (= R269), Q315 (= Q314), F316 (= F315), V346 (≠ C346)
Sites not aligning to the query:
4ywoA Mercuric reductase from metallosphaera sedula (see paper)
34% identity, 93% coverage: 7:452/480 of query aligns to 8:438/444 of 4ywoA
- active site: A15 (= A14), I39 (≠ L39), C43 (= C43), C48 (= C48), S51 (= S51), A174 (≠ P181), E178 (= E185), G308 (= G320), H425 (≠ M439), F427 (≠ Y441), E432 (= E446)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), K36 (≠ R35), G41 (= G41), T42 (≠ D42), C43 (= C43), G47 (= G47), C48 (= C48), K52 (= K52), A110 (= A117), A133 (= A140), T134 (= T141), G135 (= G142), N154 (= N161), L175 (≠ I182), L263 (= L276), G295 (= G307), D296 (= D308), M302 (≠ Q314), L303 (≠ F315), E304 (≠ T316), A307 (= A319)
2eq6A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8
37% identity, 92% coverage: 6:446/480 of query aligns to 5:442/460 of 2eq6A
- active site: V37 (≠ L39), C41 (= C43), C46 (= C48), T49 (≠ S51), A176 (≠ P181), E180 (= E185), H435 (≠ M439), H437 (≠ Y441), E442 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), P13 (≠ A14), G14 (≠ A15), E33 (≠ D34), A34 (≠ R35), G39 (= G41), V40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K50 (= K52), F111 (≠ D116), A112 (= A117), A135 (= A140), T136 (= T141), G137 (= G142), S155 (≠ T160), R269 (≠ N272), D306 (= D308), L312 (≠ Q314), L313 (≠ F315), A314 (≠ T316), H315 (= H317), Y344 (≠ F348)
Sites not aligning to the query:
3o0hB Crystal structure of glutathione reductase from bartonella henselae
32% identity, 93% coverage: 3:446/480 of query aligns to 2:440/459 of 3o0hB
- active site: S13 (≠ A14), I37 (≠ L39), C41 (= C43), C46 (= C48), K49 (≠ S51), D74 (≠ L77), P75 (= P78), Y177 (≠ P181), E181 (= E185), I314 (≠ G320), A433 (≠ M439), H435 (≠ Y441), E440 (= E446)
- binding flavin-adenine dinucleotide: I9 (= I10), G10 (= G11), G12 (= G13), S13 (≠ A14), G14 (≠ A15), A32 (= A33), E33 (≠ D34), E34 (≠ R35), T40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (≠ S51), R112 (≠ D116), A113 (= A117), T139 (= T141), G140 (= G142), Y177 (≠ P181), R262 (= R269), N265 (= N272), G301 (= G307), D302 (= D308), Q308 (= Q314), L309 (≠ F315), T310 (= T316)
Sites not aligning to the query:
2yquB Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
33% identity, 93% coverage: 6:452/480 of query aligns to 3:445/455 of 2yquB
- active site: P11 (≠ A14), L36 (= L39), C40 (= C43), C45 (= C48), S48 (= S51), G72 (= G71), V73 (≠ L72), V177 (≠ P181), E181 (= E185), S314 (≠ G320), H432 (≠ M439), H434 (≠ Y441), E439 (= E446)
- binding carbonate ion: A310 (≠ T316), S314 (≠ G320), S423 (≠ R430), D426 (≠ T433)
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), P11 (≠ A14), G12 (≠ A15), E31 (≠ D34), K32 (≠ R35), G38 (= G41), T39 (≠ D42), C40 (= C43), R42 (≠ H45), G44 (= G47), C45 (= C48), K49 (= K52), T110 (≠ D116), A111 (= A117), T137 (= T141), G138 (= G142), I178 (= I182), Y265 (≠ N272), G301 (= G307), D302 (= D308), M308 (≠ Q314), L309 (≠ F315), A310 (≠ T316), H311 (= H317)
2yquA Crystal structures and evolutionary relationship of two different lipoamide dehydrogenase(e3s) from thermus thermophilus
33% identity, 93% coverage: 6:452/480 of query aligns to 3:445/455 of 2yquA
- active site: P11 (≠ A14), L36 (= L39), C40 (= C43), C45 (= C48), S48 (= S51), G72 (= G71), V73 (≠ L72), V177 (≠ P181), E181 (= E185), S314 (≠ G320), H432 (≠ M439), H434 (≠ Y441), E439 (= E446)
- binding flavin-adenine dinucleotide: G8 (= G11), G10 (= G13), P11 (≠ A14), G12 (≠ A15), E31 (≠ D34), K32 (≠ R35), G38 (= G41), T39 (≠ D42), C40 (= C43), R42 (≠ H45), G44 (= G47), C45 (= C48), K49 (= K52), T110 (≠ D116), A111 (= A117), T137 (= T141), G138 (= G142), S157 (≠ N161), I178 (= I182), Y265 (≠ N272), G301 (= G307), D302 (= D308), M308 (≠ Q314), L309 (≠ F315), A310 (≠ T316)
2eq7A Crystal structure of lipoamide dehydrogenase from thermus thermophilus hb8 with psbdo
33% identity, 93% coverage: 6:452/480 of query aligns to 3:445/452 of 2eq7A
- active site: P11 (≠ A14), L36 (= L39), C40 (= C43), C45 (= C48), S48 (= S51), G72 (= G71), V73 (≠ L72), V177 (≠ P181), E181 (= E185), S314 (≠ G320), H432 (≠ M439), H434 (≠ Y441), E439 (= E446)
- binding flavin-adenine dinucleotide: G10 (= G13), P11 (≠ A14), G12 (≠ A15), E31 (≠ D34), K32 (≠ R35), G38 (= G41), T39 (≠ D42), C40 (= C43), R42 (≠ H45), G44 (= G47), C45 (= C48), K49 (= K52), T110 (≠ D116), A111 (= A117), T137 (= T141), G138 (= G142), S157 (≠ N161), I178 (= I182), R262 (= R269), Y265 (≠ N272), D302 (= D308), M308 (≠ Q314), L309 (≠ F315), A310 (≠ T316), H311 (= H317), Y341 (≠ F348)
- binding nicotinamide-adenine-dinucleotide: W146 (≠ F150), G174 (= G178), G176 (= G180), V177 (≠ P181), I178 (= I182), E197 (≠ Q201), Y198 (≠ R202), V231 (= V235), V260 (≠ L267), G261 (= G268), R262 (= R269), M308 (≠ Q314), L309 (≠ F315), V339 (≠ C346)
3urhB Crystal structure of a dihydrolipoamide dehydrogenase from sinorhizobium meliloti 1021
33% identity, 93% coverage: 6:452/480 of query aligns to 2:456/465 of 3urhB
- active site: Y35 (≠ L39), C39 (= C43), C44 (= C48), S47 (= S51), V183 (≠ P181), E187 (= E185), H443 (≠ M439), H445 (≠ Y441), E450 (= E446)
- binding flavin-adenine dinucleotide: I6 (= I10), G7 (= G11), G9 (= G13), P10 (≠ A14), G11 (≠ A15), E30 (≠ D34), K31 (≠ R35), G37 (= G41), T38 (≠ D42), C39 (= C43), G43 (= G47), C44 (= C48), K48 (= K52), T111 (≠ L108), G112 (= G109), A140 (= A140), T141 (= T141), G142 (= G142), I184 (= I182), R273 (= R269), G312 (= G307), D313 (= D308), M319 (≠ Q314), L320 (≠ F315), A321 (≠ T316), H322 (= H317)
2rabA Structure of glutathione amide reductase from chromatium gracile in complex with NAD (see paper)
34% identity, 93% coverage: 6:450/480 of query aligns to 5:449/451 of 2rabA
- active site: S13 (≠ A14), L37 (= L39), C41 (= C43), C46 (= C48), K49 (≠ S51), Y173 (≠ P181), E177 (= E185), I310 (≠ G320), A431 (≠ M439), H433 (≠ Y441), E438 (vs. gap)
- binding flavin-adenine dinucleotide: G10 (= G11), G12 (= G13), S13 (≠ A14), G14 (≠ A15), I32 (≠ A33), E33 (≠ D34), S34 (≠ G36), T40 (≠ D42), G45 (= G47), C46 (= C48), K49 (≠ S51), H110 (≠ D116), A111 (= A117), T135 (= T141), G136 (= G142), R258 (= R269), G297 (= G307), D298 (= D308), Q304 (= Q314), L305 (≠ F315), T306 (= T316)
- binding nicotinamide-adenine-dinucleotide: K49 (≠ S51), I169 (≠ L177), G172 (= G180), Y173 (≠ P181), I174 (= I182), E177 (= E185), A193 (≠ Q201), L194 (≠ R202), E195 (≠ G203), V227 (= V235), V256 (≠ L267), G257 (= G268), Q304 (= Q314), V337 (≠ C346)
2r9zB Glutathione amide reductase from chromatium gracile (see paper)
34% identity, 93% coverage: 6:450/480 of query aligns to 5:451/453 of 2r9zB
- active site: S13 (≠ A14), L37 (= L39), C41 (= C43), C46 (= C48), K49 (≠ S51), G74 (≠ P78), Y174 (≠ P181), E178 (= E185), I312 (≠ G320), A433 (≠ M439), H435 (≠ Y441), E440 (vs. gap)
- binding flavin-adenine dinucleotide: G12 (= G13), S13 (≠ A14), G14 (≠ A15), I32 (≠ A33), E33 (≠ D34), S34 (≠ G36), G39 (= G41), T40 (≠ D42), C41 (= C43), G45 (= G47), C46 (= C48), K49 (≠ S51), H111 (≠ D116), A112 (= A117), T136 (= T141), G137 (= G142), I175 (= I182), R260 (= R269), G299 (= G307), D300 (= D308), Q306 (= Q314), L307 (≠ F315), T308 (= T316)
D0VWY5 Glutathione amide reductase; GAR; EC 1.8.1.16 from Marichromatium gracile (Chromatium gracile) (see 2 papers)
33% identity, 94% coverage: 1:450/480 of query aligns to 1:453/463 of D0VWY5
- M1 (= M1) modified: Initiator methionine, Removed
- T2 (≠ D2) binding
- Q3 (≠ Y3) binding
- H4 (≠ D4) binding
- SG 14:15 (≠ AA 14:15) binding
- E34 (≠ D34) binding
- T41 (≠ D42) binding
- C42 (= C43) modified: Disulfide link with 47, Redox-active
- C47 (= C48) modified: Disulfide link with 42, Redox-active
- K50 (≠ S51) binding ; binding
- HA 113:114 (≠ DA 116:117) binding
- 174:180 (vs. 179:185, 43% identical) binding
- LE 197:198 (≠ RG 202:203) binding
- V230 (= V235) binding
- G261 (= G268) binding
- D302 (= D308) binding
- Q308 (= Q314) binding
- QLT 308:310 (≠ QFT 314:316) binding
- V341 (≠ C346) binding
- H437 (≠ Y441) active site, Proton acceptor; binding
Sites not aligning to the query:
- 2:463 modified: mature protein, Glutathione amide reductase
P0A9P0 Dihydrolipoyl dehydrogenase; Dihydrolipoamide dehydrogenase; E3 component of pyruvate and 2-oxoglutarate dehydrogenases complexes; Glycine cleavage system L protein; EC 1.8.1.4 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 92% coverage: 7:446/480 of query aligns to 9:450/474 of P0A9P0
- K220 (≠ A216) modified: N6-acetyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4jdrA Dihydrolipoamide dehydrogenase of pyruvate dehydrogenase from escherichia coli (see paper)
31% identity, 92% coverage: 7:446/480 of query aligns to 8:449/471 of 4jdrA
- active site: P15 (≠ A14), L40 (= L39), C44 (= C43), C49 (= C48), S52 (= S51), E77 (≠ L72), P78 (= P73), I184 (≠ P181), E188 (= E185), V324 (≠ G320), H442 (≠ M439), H444 (≠ Y441), E449 (= E446)
- binding flavin-adenine dinucleotide: G12 (= G11), G14 (= G13), P15 (≠ A14), A16 (= A15), E35 (≠ D34), R36 (= R35), Y37 (≠ G36), V43 (≠ D42), C44 (= C43), G48 (= G47), C49 (= C48), K53 (= K52), L115 (= L108), G116 (= G109), A144 (≠ T141), G145 (= G142), I185 (= I182), G311 (= G307), D312 (= D308), M318 (≠ Q314), L319 (≠ F315), A320 (≠ T316), H321 (= H317)
Sites not aligning to the query:
Query Sequence
>206471 MicrobesOnline__882:206471
MDYDADLLVIGGGAAGLTVAAGAARLGARVVLADRGPTLGGDCLHHGCVPSKTLIASARA
RRTMRDAPRFGLPEVALPPVDFKAVAAHIAGVQSVIQKHDSVERFSGLGVEVRFGDAVFV
DEHTVAVEGRRISARRIVVATGSSPQIPAFPGLADTPYLTNRDIFTLETLPASLIVLGGG
PIAVEMAQAFARLGSRVVLVQRGGHILSREDADMAAVVHEALEQDGVRIMTGATVEVARR
QDAGVVVTVRVGDEHVDVHGERLLVALGRTPNVEGLHLGNAGVVFSERGVPVDARMRTSQ
SHILAAGDVTGAWQFTHAAGYEGSVVVANAVLRLPRKAKYDRMPWCTFTDPELASVGLNE
REAHRQGIGVDVHTESFSSNDRALAEGTACGLLKLVLARGTQRVLGVQIAGPHAGELING
WCMALGGGVRLTTLAGGVMPYPTLGEISRRVAGNIVSEALFSDKVRNVLCTLFRYRGKGC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory