SitesBLAST
Comparing 206527 MicrobesOnline__882:206527 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
41% identity, 99% coverage: 7:453/453 of query aligns to 1:444/446 of 6yu6B
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
41% identity, 98% coverage: 7:451/453 of query aligns to 1:442/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
41% identity, 98% coverage: 7:451/453 of query aligns to 1:442/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S24), A19 (= A25), G21 (= G27), L22 (= L28), G23 (= G29), Y101 (= Y108), F223 (= F229), T224 (≠ K230), S226 (= S232), M229 (= M235), L321 (= L327)
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
42% identity, 98% coverage: 7:448/453 of query aligns to 1:439/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
42% identity, 98% coverage: 7:448/453 of query aligns to 1:439/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
42% identity, 98% coverage: 7:448/453 of query aligns to 1:439/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
42% identity, 98% coverage: 7:448/453 of query aligns to 1:439/441 of 4us3A
- binding sodium ion: G17 (= G23), A19 (= A25), V20 (= V26), V20 (= V26), G21 (= G27), N24 (= N30), T224 (≠ K230), D256 (= D262), A313 (= A319), S316 (≠ G322), S317 (≠ A323)
- binding tryptophan: S18 (= S24), A19 (= A25), L22 (= L28), G23 (= G29), Y101 (= Y108), F223 (= F229), T224 (≠ K230), S226 (= S232), M229 (= M235), S320 (= S326), L321 (= L327)
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
41% identity, 96% coverage: 16:451/453 of query aligns to 1:433/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ V189), T180 (= T196), I287 (≠ M302), R288 (≠ P303), L289 (≠ G304)
- binding sodium ion: G8 (= G23), S9 (= S24), A10 (= A25), V11 (= V26), V11 (= V26), N15 (= N30), T215 (≠ K230), D247 (= D262), A304 (= A319), S307 (≠ G322), S308 (≠ A323)
- binding tryptophan: S9 (= S24), A10 (= A25), G12 (= G27), G14 (= G29), Y92 (= Y108), F214 (= F229), T215 (≠ K230), S217 (= S232), M220 (= M235), L312 (= L327)
3f3aA Crystal structure of leut bound to l-tryptophan and sodium (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:458/504 of 3f3aA
- binding sodium ion: G16 (= G23), N17 (≠ S24), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), N23 (= N30), T247 (≠ K230), N279 (vs. gap), A344 (= A319), T347 (≠ G322), S348 (≠ A323)
- binding tryptophan: R7 (= R14), A18 (= A25), G20 (= G27), L21 (= L28), G22 (= G29), R26 (≠ K33), Y104 (= Y108), G242 (= G225), F246 (= F229), F246 (= F229), T247 (≠ K230), S249 (= S232), F252 (≠ M235), D265 (= D248), Q266 (= Q249), D267 (≠ N250), F299 (= F274), N303 (≠ F278), A306 (≠ G281), I307 (≠ F282), A310 (≠ S285), N314 (≠ S289), S348 (≠ A323), I352 (≠ L327), D397 (= D383), G401 (≠ S387), T402 (≠ N388), G432 (= G418)
3uslA Crystal structure of leut bound to l-selenomethionine in space group c2 from lipid bicelles (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:458/502 of 3uslA
- binding selenomethionine: A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F246 (= F229), T247 (≠ K230), S249 (= S232), S348 (≠ A323), I352 (≠ L327)
- binding sodium ion: G16 (= G23), N17 (≠ S24), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), N23 (= N30), T247 (≠ K230), N279 (vs. gap), A344 (= A319), T347 (≠ G322), S348 (≠ A323)
- binding phosphocholine: N83 (≠ E82), R84 (≠ L83), F85 (≠ G84)
3usgA Crystal structure of leut bound to l-leucine in space group c2 from lipid bicelles (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:458/502 of 3usgA
- binding leucine: A18 (= A25), G20 (= G27), G22 (= G29), F246 (= F229), T247 (≠ K230), S249 (= S232), F252 (≠ M235)
- binding sodium ion: G16 (= G23), N17 (≠ S24), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), N23 (= N30), T247 (≠ K230), N279 (vs. gap), A344 (= A319), T347 (≠ G322), S348 (≠ A323)
- binding phosphocholine: N83 (≠ E82), R84 (≠ L83)
3mpnA F177r1 mutant of leut (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/505 of 3mpnA
- binding leucine: N17 (≠ S24), A18 (= A25), G20 (= G27), L21 (= L28), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232), F253 (≠ M235), S349 (≠ A323)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (≠ A158), A377 (= A351)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/498 of 3gwvA
- binding leucine: A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232), F253 (≠ M235)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L28), R26 (≠ K33), A313 (≠ G287), F314 (≠ P288), L394 (≠ F379), D395 (= D380), D398 (= D383)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/509 of 3gwuA
- binding leucine: A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232), F253 (≠ M235)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W32), R26 (≠ K33), Y104 (= Y108), F247 (= F229), A313 (≠ G287), D395 (= D380), D398 (= D383)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/509 of 3f4jA
- binding glycine: A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232)
- binding sodium ion: G16 (= G23), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), G22 (= G29), N23 (= N30), T248 (≠ K230), N280 (vs. gap), A345 (= A319), G346 (≠ A320), T348 (≠ G322), S349 (≠ A323)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/509 of 3f3dA
- binding methionine: N17 (≠ S24), A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232), S349 (≠ A323), I353 (≠ L327)
- binding sodium ion: G16 (= G23), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), N23 (= N30), T248 (≠ K230), N280 (vs. gap), A345 (= A319), T348 (≠ G322), S349 (≠ A323)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 1:459/509 of 3f3cA
- binding sodium ion: G16 (= G23), A18 (= A25), V19 (= V26), V19 (= V26), G20 (= G27), N23 (= N30), T248 (≠ K230), N280 (vs. gap), A345 (= A319), T348 (≠ G322), S349 (≠ A323)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S24), A18 (= A25), G20 (= G27), G22 (= G29), Y104 (= Y108), F247 (= F229), T248 (≠ K230), S250 (= S232), F253 (≠ M235), S349 (≠ A323), I353 (≠ L327)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 3:461/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K33), Q32 (≠ L37), R189 (= R174), F190 (≠ T175), I193 (= I178), F316 (≠ P288), F346 (≠ I318), L396 (≠ F379), D397 (= D380)
- binding leucine: A20 (= A25), G22 (= G27), G24 (= G29), Y106 (= Y108), F249 (= F229), T250 (≠ K230), S252 (= S232), F255 (≠ M235)
- binding sodium ion: G18 (= G23), A20 (= A25), V21 (= V26), V21 (= V26), G22 (= G27), N25 (= N30), T250 (≠ K230), N282 (vs. gap), A347 (= A319), T350 (≠ G322), S351 (≠ A323)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 2:460/511 of 2qeiA
- binding alanine: A19 (= A25), G21 (= G27), G23 (= G29), Y105 (= Y108), F248 (= F229), T249 (≠ K230), S251 (= S232)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K33), V30 (≠ A36), Q31 (≠ L37), Y104 (≠ F107), R180 (≠ G166), R188 (= R174), F189 (≠ T175), F315 (≠ P288), F345 (≠ I318), D396 (= D380), D399 (= D383)
- binding sodium ion: G17 (= G23), A19 (= A25), V20 (= V26), V20 (= V26), G21 (= G27), N24 (= N30), T249 (≠ K230), N281 (vs. gap), A346 (= A319), T349 (≠ G322), S350 (≠ A323)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
30% identity, 97% coverage: 8:447/453 of query aligns to 2:460/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K33), V30 (≠ A36), Q31 (≠ L37), R188 (= R174), F189 (≠ T175), I192 (= I178), A314 (≠ G287), F315 (≠ P288), F345 (≠ I318), D396 (= D380)
- binding leucine: A19 (= A25), G21 (= G27), L22 (= L28), G23 (= G29), Y105 (= Y108), F248 (= F229), T249 (≠ K230), S251 (= S232), F254 (≠ M235)
- binding sodium ion: G17 (= G23), A19 (= A25), V20 (= V26), V20 (= V26), G21 (= G27), N24 (= N30), T249 (≠ K230), N281 (vs. gap), A346 (= A319), T349 (≠ G322), S350 (≠ A323)
Query Sequence
>206527 MicrobesOnline__882:206527
MAQQTSGRDGFATRLGVLAATLGSAVGLGNIWKFPALTGQNGGATFLLVYIIATLLVGLP
VMISEIMLGRKAKANAVRTYRELGPKGQPWSLIGISGVIAAVLIMGFYTDVAGWVFAYIF
KAMSGSIATTDPAVAKEAFVALVGSPTQSLMWQWIVLALVSAIILGGVSSGIERTTKILM
PVLLLLLCVVCARSLTLPKAAEGLAFLFTPDFSKITGGVILMALGLAFFKLSIGMGTMTT
YGSYFRDDQNIPVTAARVMLCDLSISILAGVAIFPAVFNFGFEPSAGPSLLFMTIPAVFA
SMPGGQLFTVIFFCLTAIAATGAMLSLFEVPVAWLVEEFKMSRAKATIGTALVLGVMGAP
ATLSMSVLGDFKMFGLNMFDLYDFVSSNILLPVGGIFICIFAGWVWGSKRTRELLSNGGH
LDNAAVVSGFLFVVKWVSPVLVTIVLLNGLKLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory