Comparing 206601 MicrobesOnline__882:206601 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
A0LNN5 L-lactate transporter; SfMCT from Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) (see paper)
30% identity, 88% coverage: 7:381/424 of query aligns to 10:383/412 of A0LNN5
6zguA Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
30% identity, 88% coverage: 7:381/424 of query aligns to 4:367/404 of 6zguA
6zgtA Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
30% identity, 88% coverage: 7:381/424 of query aligns to 4:367/404 of 6zgtA
6zgsA Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
30% identity, 88% coverage: 7:381/424 of query aligns to 4:367/404 of 6zgsA
6zgrA Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
30% identity, 88% coverage: 7:381/424 of query aligns to 4:362/399 of 6zgrA
6g9xA Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
30% identity, 88% coverage: 7:381/424 of query aligns to 4:359/396 of 6g9xA
6zguB Crystal structure of a mfs transporter with bound 3-(2-methylphenyl) propanoic acid at 2.41 angstroem resolution
30% identity, 84% coverage: 24:381/424 of query aligns to 16:341/364 of 6zguB
6zgtB Crystal structure of a mfs transporter with bound 2-naphthoic acid at 2.39 angstroem resolution
30% identity, 84% coverage: 24:381/424 of query aligns to 16:341/364 of 6zgtB
6zgsB Crystal structure of a mfs transporter with bound 3-phenylpropanoic acid at 2.39 angstroem resolution
30% identity, 84% coverage: 24:381/424 of query aligns to 16:341/364 of 6zgsB
6zgrB Crystal structure of a mfs transporter with bound 1- hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution
29% identity, 84% coverage: 24:381/424 of query aligns to 18:340/364 of 6zgrB
6g9xB Crystal structure of a mfs transporter at 2.54 angstroem resolution (see paper)
29% identity, 84% coverage: 24:381/424 of query aligns to 18:341/368 of 6g9xB
Q51330 Oxalate:formate antiporter; OFA; Oxalate:formate antiport protein; Oxalate:formate exchange protein from Oxalobacter formigenes (see 4 papers)
26% identity, 97% coverage: 6:418/424 of query aligns to 15:413/418 of Q51330
Sites not aligning to the query:
8hpkA Crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form (see paper)
27% identity, 85% coverage: 6:367/424 of query aligns to 5:347/390 of 8hpkA
Q6ZSM3 Monocarboxylate transporter 12; MCT 12; Creatine transporter 2; CRT2; Solute carrier family 16 member 12 from Homo sapiens (Human) (see 3 papers)
22% identity, 82% coverage: 78:424/424 of query aligns to 120:478/516 of Q6ZSM3
Sites not aligning to the query:
>206601 MicrobesOnline__882:206601
MDKVKNRWLIAASAVGVHISIGSVYAYSVMTLPLNQLHGWQKSNITLAFSLAILFLGFSA
AFLGRSVEKMGPRNSGRLAGILYTAGIMGAGIAVKLGSLPLFLLSYGVIGGIGLGVGYIT
PVSTLVKWFPDRRGLATGMAIMGFGFAAMIFGPIMAKLFQIMEIWQVYFVLGAIYFCLIY
GSSLYLAPPPEGWVPPGYAAQGQQSAGRTLKRDLGQYTVAEAIRTKRFYFMWLMLFINIT
CGIALISVASPMAQEVIGLSPMQAATMVGLMGLFNGGGRIGWASLSDYLGRGRTYMAFFL
IQICAFMALTTTTSHLGFQCLIFIILTCYGGGFSTLPAFLGDMFGTKQLGTIHGYELTAW
GIAGMVGPSIVTRVLEATGSYTMTLYIFTGFLTFAFIVSCLLCMDLRQIRRRMFLEQQAA
GETS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory