Comparing 206675 DVU1236 amino acid ABC transporter, ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
65% identity, 98% coverage: 7:247/247 of query aligns to 1:240/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
60% identity, 97% coverage: 8:247/247 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
60% identity, 97% coverage: 8:247/247 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
60% identity, 97% coverage: 8:247/247 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
60% identity, 97% coverage: 8:247/247 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
60% identity, 97% coverage: 8:247/247 of query aligns to 1:240/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
50% identity, 97% coverage: 5:244/247 of query aligns to 3:254/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
50% identity, 96% coverage: 9:244/247 of query aligns to 3:250/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 97% coverage: 8:247/247 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
42% identity, 97% coverage: 8:247/247 of query aligns to 2:246/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
42% identity, 97% coverage: 8:247/247 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
42% identity, 97% coverage: 8:247/247 of query aligns to 2:246/344 of 3tuiC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 91% coverage: 9:234/247 of query aligns to 7:234/375 of 2d62A
1g291 Malk (see paper)
37% identity, 95% coverage: 9:243/247 of query aligns to 4:240/372 of 1g291
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 94% coverage: 14:244/247 of query aligns to 32:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
39% identity, 94% coverage: 14:244/247 of query aligns to 32:264/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
40% identity, 89% coverage: 14:234/247 of query aligns to 32:254/260 of 7ahdC
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
38% identity, 96% coverage: 8:243/247 of query aligns to 4:228/348 of 3d31A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 97% coverage: 7:246/247 of query aligns to 16:251/378 of P69874
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
37% identity, 90% coverage: 8:230/247 of query aligns to 3:226/229 of 6z67B
>206675 DVU1236 amino acid ABC transporter, ATP-binding protein
MTAANEPIISIRNVWKFFGELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLENV
DKGSIIVDGKDIRAEDSDINVIRQDLGMVFQSFNLFPHKTVLQNLTMAPMRLRKVPRDEA
ESRALDLLKKVGISDKANVYPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDPEMIG
EVLDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFFEAPEHPRLQ
KFLQQIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory