Comparing 206677 MicrobesOnline__882:206677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
42% identity, 90% coverage: 24:245/246 of query aligns to 5:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
41% identity, 90% coverage: 24:245/246 of query aligns to 5:226/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
37% identity, 87% coverage: 31:243/246 of query aligns to 18:226/229 of 6svfA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 91% coverage: 22:246/246 of query aligns to 4:226/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 91% coverage: 23:246/246 of query aligns to 1:222/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 91% coverage: 22:246/246 of query aligns to 10:232/241 of 2q2aA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 89% coverage: 25:243/246 of query aligns to 3:221/224 of 4ymxA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
34% identity, 90% coverage: 24:244/246 of query aligns to 11:228/229 of 5t0wA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
32% identity, 90% coverage: 23:244/246 of query aligns to 6:227/228 of 2y7iA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
30% identity, 88% coverage: 30:245/246 of query aligns to 20:231/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
30% identity, 88% coverage: 30:245/246 of query aligns to 24:235/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
30% identity, 88% coverage: 30:245/246 of query aligns to 24:235/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
30% identity, 88% coverage: 30:245/246 of query aligns to 24:235/241 of 3vvdA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 83% coverage: 30:234/246 of query aligns to 21:224/235 of 4g4pA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
32% identity, 84% coverage: 28:234/246 of query aligns to 11:216/230 of 4kqpA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
33% identity, 90% coverage: 24:244/246 of query aligns to 3:225/225 of 3tqlA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
32% identity, 85% coverage: 26:234/246 of query aligns to 19:226/239 of 4zefA
4ohnA Crystal structure of an abc uptake transporter substrate binding protein from streptococcus pneumoniae with bound histidine
29% identity, 92% coverage: 21:246/246 of query aligns to 11:241/246 of 4ohnA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
32% identity, 86% coverage: 24:234/246 of query aligns to 1:210/223 of 8b5dA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
32% identity, 87% coverage: 22:234/246 of query aligns to 2:213/226 of 6fxgB
>206677 MicrobesOnline__882:206677
MLQKVLLTVAALLLSTNVAFAERTVVFAHDATWPPMEFVDANKQIVGLAVDYVDAIAKEA
GFKVVHKNVAWDGIFAGLAAGKYDAIASSVTITEERKKAMDFTMPYFDVKQALVVPKTTE
AKTLEDMKGKTLGAQISTTGHFAIKRTAGVTAKSYDEIGLAMEDLFNGRIDGVVCDDPVA
ANYALQQEEYAKKLKIAFIVDTPESEYYGIAVKQGNKELVDLINKGIEAVKAKGIDAQLR
AKWIGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory