SitesBLAST
Comparing 206724 MicrobesOnline__882:206724 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
52% identity, 93% coverage: 3:273/292 of query aligns to 3:274/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P11), A13 (= A13), G14 (= G14), K28 (= K28), E29 (= E29), Q106 (= Q105), A109 (≠ Q108), L110 (= L109), G111 (= G110), L112 (= L111), A115 (= A114), D135 (= D134), Y172 (= Y171), G173 (= G172), E192 (= E191), K193 (= K192), V205 (≠ I204)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
48% identity, 97% coverage: 3:285/292 of query aligns to 1:280/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P11), V10 (= V12), A11 (= A13), G12 (= G14), G14 (= G16), T15 (= T17), R16 (= R18), K26 (= K28), E27 (= E29), Q104 (= Q105), A107 (≠ Q108), G109 (= G110), A113 (= A114)
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
45% identity, 91% coverage: 4:268/292 of query aligns to 7:273/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P11), A16 (= A13), G17 (= G14), K31 (= K28), E32 (= E29), Q108 (= Q105), G113 (= G110), L114 (= L111), A117 (= A114), L134 (≠ V131), D137 (= D134), E196 (= E191), K197 (= K192), I209 (= I204)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
46% identity, 96% coverage: 5:285/292 of query aligns to 5:280/288 of 2ux8G
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 91% coverage: 5:269/292 of query aligns to 2:261/264 of 3jukD
- binding magnesium ion: T14 (= T17), R15 (= R18)
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), E26 (= E29), Q94 (= Q105), M97 (≠ Q108), G99 (= G110), L100 (= L111), A103 (= A114), L120 (≠ V131), D123 (= D134), Y162 (= Y171), G163 (= G172), E182 (= E191), K183 (= K192), V195 (≠ I204)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
41% identity, 91% coverage: 5:269/292 of query aligns to 2:261/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (= A13), G11 (= G14), E26 (= E29), Q94 (= Q105), M97 (≠ Q108), G99 (= G110), L100 (= L111), A103 (= A114), D123 (= D134), Y162 (= Y171), G163 (= G172), E182 (= E191), K183 (= K192), V195 (≠ I204)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
41% identity, 93% coverage: 5:276/292 of query aligns to 2:278/290 of 6knlA
- binding triphosphate: G13 (= G16), T14 (= T17), R15 (= R18), K79 (≠ A82), K81 (= K84)
- binding uridine: P8 (= P11), G11 (= G14), K25 (= K28), Q103 (= Q105), P106 (≠ Q108), G108 (= G110), P130 (≠ G132), D131 (= D133)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
41% identity, 93% coverage: 5:276/292 of query aligns to 2:278/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), Q103 (= Q105), P106 (≠ Q108), G108 (= G110), L109 (= L111), A112 (= A114), L129 (≠ V131), D131 (= D133), E193 (= E191), V206 (≠ I204)
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
40% identity, 93% coverage: 5:276/292 of query aligns to 2:273/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P11), V9 (= V12), A10 (= A13), G11 (= G14), L12 (≠ W15), G13 (= G16), T14 (= T17), R15 (= R18), K25 (= K28), Q103 (= Q105), P106 (≠ Q108), G108 (= G110), D131 (= D133)
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
40% identity, 93% coverage: 5:276/292 of query aligns to 5:242/255 of 2ux8A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
39% identity, 92% coverage: 5:273/292 of query aligns to 3:275/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P11), A10 (≠ V12), A11 (= A13), G12 (= G14), E27 (= E29), Q103 (= Q105), P106 (≠ Q108), G108 (= G110), L109 (= L111), L131 (≠ V131), P132 (≠ G132), D134 (= D134), Y170 (= Y171), G171 (= G172), E192 (= E191), K193 (= K192), A205 (≠ I204)
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
38% identity, 91% coverage: 8:273/292 of query aligns to 5:273/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P11), A10 (= A13), G11 (= G14), L12 (≠ W15), G13 (= G16), T14 (= T17), R15 (= R18), K25 (= K28), Q102 (= Q105), A105 (≠ Q108), G107 (= G110), A111 (= A114)
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
37% identity, 91% coverage: 9:273/292 of query aligns to 6:268/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), Q102 (= Q105), A105 (≠ Q108), G107 (= G110), A111 (= A114), L130 (≠ V131), P131 (≠ G132), D133 (= D134), A203 (≠ I204), G205 (= G206)
5z09A St0452(y97n)-utp binding form (see paper)
27% identity, 94% coverage: 7:280/292 of query aligns to 2:239/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (≠ P11), A7 (≠ V12), A8 (= A13), G9 (= G14), S10 (≠ W15), G11 (= G16), E12 (≠ T17), R13 (= R18), Q73 (= Q105), G79 (= G110), G98 (≠ D133), D99 (= D134)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
27% identity, 94% coverage: 7:280/292 of query aligns to 2:239/401 of 2ggqA
- active site: R13 (= R18)
- binding thymidine-5'-triphosphate: L6 (≠ P11), A8 (= A13), G9 (= G14), S10 (≠ W15), G11 (= G16), E12 (≠ T17), R13 (= R18), K23 (= K28), Q73 (= Q105), G79 (= G110), A83 (= A114), R179 (≠ G226), E181 (= E228)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
27% identity, 94% coverage: 7:280/292 of query aligns to 2:239/401 of Q975F9
- AGSGER 8:13 (≠ AGWGTR 13:18) binding
- Q73 (= Q105) binding
- G79 (= G110) binding
- T80 (≠ L111) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ G132) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E191) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
4b5bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 93% coverage: 6:277/292 of query aligns to 3:249/293 of 4b5bA
Sites not aligning to the query:
4b4gA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 93% coverage: 6:277/292 of query aligns to 3:249/293 of 4b4gA
Sites not aligning to the query:
4b42A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 93% coverage: 6:277/292 of query aligns to 3:249/293 of 4b42A
Sites not aligning to the query:
4b3uA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
26% identity, 93% coverage: 6:277/292 of query aligns to 9:255/299 of 4b3uA
Sites not aligning to the query:
Query Sequence
>206724 MicrobesOnline__882:206724
MPVNIRKVVIPVAGWGTRSLPATKNIPKEMLPVYNKPVVQYVVEEAQKSGIGDVVFVTNR
DKKIIEDHFDYNLQLESVLERAGKTEMLRQVREVAEMVNIISVRQKKQLGLGHAVLCARE
IVRDEPFAVMVGDDLMFGMTPGIQQLIDVAVAEHLPVIGVMEVPADKVSRYGIIAGEETA
PGIYKVSRLVEKPSIAEAPSRLAIVGRYVLTPDIFDSLEKVKPGHGGEIQLTDALQNLAD
DRGLLAVKIRGMRFDAGDWAEYLTANIYFALQEEGLRDDLISQLRPLLPFRC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory