SitesBLAST
Comparing 206802 MicrobesOnline__882:206802 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c20A Crystal structure of udp-glucose 4-epimerase
50% identity, 97% coverage: 8:328/331 of query aligns to 1:322/329 of 2c20A
- active site: T117 (≠ S123), A118 (= A124), A119 (= A125), Y141 (= Y147), K145 (= K151), H184 (= H190)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), Y11 (= Y18), I12 (= I19), D31 (= D38), N32 (= N39), Q34 (≠ S41), T35 (= T42), G36 (= G43), D51 (= D57), L52 (= L58), F73 (= F79), A74 (≠ S80), A75 (= A81), N92 (= N98), Y141 (= Y147), K145 (= K151), Y168 (= Y174), F169 (= F175), V171 (≠ A177), H184 (= H190)
- binding zinc ion: E182 (= E188), H184 (= H190), E187 (= E193), H189 (= H195)
4twrA Structure of udp-glucose 4-epimerase from brucella abortus
50% identity, 95% coverage: 7:322/331 of query aligns to 1:316/325 of 4twrA
- active site: S117 (= S123), C118 (≠ A124), A119 (= A125), Y141 (= Y147), K145 (= K151), H184 (= H190), H189 (= H195)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), F12 (≠ Y18), I13 (= I19), D32 (= D38), N33 (= N39), L34 (= L40), S35 (= S41), T36 (= T42), G37 (= G43), D51 (= D57), I52 (≠ L58), F73 (= F79), A74 (≠ S80), A75 (= A81), N92 (= N98), S115 (= S121), K145 (= K151), Y168 (= Y174), A171 (= A177), H184 (= H190)
- binding zinc ion: E182 (= E188), H184 (= H190), E187 (= E193), H189 (= H195)
7k3pA The structure of the udp-glc/glcnac 4-epimerase from the human pathogen campylobacter jejuni
43% identity, 97% coverage: 8:328/331 of query aligns to 2:328/329 of 7k3pA
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), S35 (= S41), G37 (= G43), D57 (= D57), L58 (= L58), F79 (= F79), A80 (≠ S80), I83 (≠ S83), N98 (= N98), Y147 (= Y147), K151 (= K151), Y175 (= Y174), N177 (= N176), V178 (≠ A177)
2cnbA Trypanosoma brucei udp-galactose-4-epimerase in ternary complex with NAD and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose (see paper)
44% identity, 96% coverage: 10:327/331 of query aligns to 5:359/366 of 2cnbA
- active site: S144 (= S123), A145 (= A124), A146 (= A125), Y169 (= Y147), K173 (= K151)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G12 (= G17), Y13 (= Y18), I14 (= I19), D34 (= D38), S35 (≠ N39), V37 (vs. gap), G38 (vs. gap), D77 (= D57), V78 (≠ L58), M100 (≠ F79), C101 (≠ S80), A102 (= A81), L104 (≠ S83), N119 (= N98), S143 (= S122), S144 (= S123), Y169 (= Y147), K173 (= K151), Y196 (= Y174), F197 (= F175), A199 (= A177)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: L104 (≠ S83), S144 (= S123), Y169 (= Y147), F197 (= F175), N198 (= N176), H217 (= H195), L218 (= L196), P238 (vs. gap), I239 (= I213), F240 (= F214), C251 (= C225), R253 (= R227), V297 (= V265), R320 (= R288), D323 (= D291)
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
43% identity, 97% coverage: 8:328/331 of query aligns to 3:339/346 of 1ek6A
- active site: S132 (= S123), A133 (= A124), T134 (≠ A125), Y157 (= Y147), K161 (= K151)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G14), G12 (= G17), Y13 (= Y18), I14 (= I19), D33 (= D38), N34 (= N39), H36 (≠ S41), N37 (≠ T42), D66 (= D57), I67 (≠ L58), F88 (= F79), A89 (≠ S80), G90 (≠ A81), K92 (≠ S83), S130 (= S121), S131 (= S122), S132 (= S123), Y157 (= Y147), K161 (= K151), Y185 (= Y174), P188 (≠ A177)
- binding uridine-5'-diphosphate-glucose: S132 (= S123), Y157 (= Y147), F186 (= F175), N187 (= N176), N207 (≠ H195), L208 (= L196), N224 (≠ K212), V225 (≠ I213), F226 (= F214), R239 (= R227), Y241 (= Y229), V277 (= V265), R300 (= R288), D303 (= D291)
1gy8C Trypanosoma brucei udp-galactose 4' epimerase (see paper)
43% identity, 96% coverage: 10:327/331 of query aligns to 5:363/370 of 1gy8C
- active site: S144 (= S123), A145 (= A124), A146 (= A125), Y170 (= Y147), K174 (= K151)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G12 (= G17), Y13 (= Y18), I14 (= I19), D34 (= D38), S35 (≠ N39), L36 (= L40), V37 (vs. gap), G38 (vs. gap), D77 (= D57), V78 (≠ L58), M100 (≠ F79), C101 (≠ S80), A102 (= A81), L104 (≠ S83), N119 (= N98), S142 (= S121), S143 (= S122), S144 (= S123), Y170 (= Y147), K174 (= K151), Y197 (= Y174), A200 (= A177)
- binding uridine-5'-diphosphate: N199 (= N176), H218 (= H195), L219 (= L196), I222 (≠ N199), M241 (≠ L211), P242 (≠ K212), I243 (= I213), F244 (= F214), C255 (= C225), R257 (= R227), R324 (= R288), D327 (= D291)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
43% identity, 97% coverage: 8:328/331 of query aligns to 3:339/348 of Q14376
- GYI 12:14 (= GYI 17:19) binding
- DNFHN 33:37 (≠ DNLST 38:42) binding
- N34 (= N39) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (≠ DL 57:58) binding
- F88 (= F79) binding
- G90 (≠ A81) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (≠ S83) binding
- V94 (= V85) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ I94) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S123) mutation to A: Loss of activity.
- SAT 132:134 (≠ SAA 123:125) binding
- Y157 (= Y147) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K151) binding
- A180 (≠ S169) to V: in dbSNP:rs3204468
- L183 (= L172) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y174) binding
- YFN 185:187 (= YFN 174:176) binding
- NNL 206:208 (≠ THL 194:196) binding
- NVF 224:226 (≠ KIF 212:214) binding
- R239 (= R227) binding
- K257 (≠ Y245) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 288:291) binding
- C307 (≠ L295) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (= L301) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G307) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (= R324) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
43% identity, 97% coverage: 8:328/331 of query aligns to 2:338/345 of 1hzjA
- active site: S131 (= S123), A132 (= A124), T133 (≠ A125), Y156 (= Y147), K160 (= K151)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), H35 (≠ S41), N36 (≠ T42), D65 (= D57), I66 (≠ L58), F87 (= F79), A88 (≠ S80), G89 (≠ A81), K91 (≠ S83), S129 (= S121), S131 (= S123), Y156 (= Y147), K160 (= K151), Y184 (= Y174), P187 (≠ A177)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N176), N206 (≠ H195), L207 (= L196), N223 (≠ K212), V224 (≠ I213), F225 (= F214), R238 (= R227), Y240 (= Y229), V276 (= V265), R299 (= R288), D302 (= D291)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
43% identity, 97% coverage: 8:328/331 of query aligns to 2:338/347 of 1i3lA
- active site: S131 (= S123), A132 (= A124), T133 (≠ A125), Y156 (= Y147), K160 (= K151)
- binding galactose-uridine-5'-diphosphate: N186 (= N176), N206 (≠ H195), L207 (= L196), N223 (≠ K212), V224 (≠ I213), F225 (= F214), R238 (= R227), Y240 (= Y229), V276 (= V265), R299 (= R288), D302 (= D291)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), H35 (≠ S41), N36 (≠ T42), D65 (= D57), I66 (≠ L58), F87 (= F79), A88 (≠ S80), G89 (≠ A81), K91 (≠ S83), S129 (= S121), S130 (= S122), S131 (= S123), Y156 (= Y147), K160 (= K151), Y184 (= Y174), P187 (≠ A177)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
43% identity, 97% coverage: 8:328/331 of query aligns to 2:338/347 of 1i3kA
- active site: S131 (= S123), A132 (= A124), T133 (≠ A125), Y156 (= Y147), K160 (= K151)
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), H35 (≠ S41), N36 (≠ T42), D65 (= D57), I66 (≠ L58), F87 (= F79), A88 (≠ S80), G89 (≠ A81), K91 (≠ S83), S129 (= S121), S131 (= S123), Y156 (= Y147), K160 (= K151), Y184 (= Y174), P187 (≠ A177)
- binding uridine-5'-diphosphate-glucose: F185 (= F175), N186 (= N176), N206 (≠ H195), L207 (= L196), N223 (≠ K212), V224 (≠ I213), F225 (= F214), R238 (= R227), Y240 (= Y229), V276 (= V265), R299 (= R288), D302 (= D291)
8wovB Crystal structure of arabidopsis thaliana udp-glucose 4-epimerase 2 (atuge2) complexed with udp, g233a mutant (see paper)
44% identity, 98% coverage: 8:331/331 of query aligns to 3:339/341 of 8wovB
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G12 (= G17), Y13 (= Y18), I14 (= I19), D33 (= D38), N34 (= N39), D36 (≠ S41), N37 (≠ T42), S38 (≠ G43), D63 (= D57), L64 (= L58), F85 (= F79), A86 (≠ S80), G87 (≠ A81), K89 (≠ S83), N104 (= N98), S127 (= S121), S129 (= S123), Y153 (= Y147), K157 (= K151), Y181 (= Y174), P184 (≠ A177)
- binding uridine-5'-diphosphate: N183 (= N176), N203 (≠ H195), L204 (= L196), L219 (= L211), T220 (≠ K212), F222 (= F214), R235 (= R227), Y237 (= Y229), R297 (= R288), D300 (= D291)
Q9SA77 UDP-arabinose 4-epimerase 1; UDP-D-xylose 4-epimerase 1; EC 5.1.3.5 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
41% identity, 98% coverage: 8:330/331 of query aligns to 71:406/419 of Q9SA77
- G275 (≠ P198) mutation to D: In mur4-1; 50% reduction in L-Ara in cell wall material.
- R304 (= R227) mutation to Q: In mur4-3; 50% reduction in L-Ara in cell wall material.
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
44% identity, 96% coverage: 9:327/331 of query aligns to 4:331/336 of 7kn1A
- active site: S126 (= S123), Y150 (= Y147), K154 (= K151)
- binding nicotinamide-adenine-dinucleotide: G9 (= G14), G12 (= G17), Y13 (= Y18), I14 (= I19), D33 (= D38), S34 (≠ N39), C36 (≠ S41), N37 (≠ T42), D60 (= D57), I61 (≠ L58), F82 (= F79), A83 (≠ S80), A84 (= A81), K86 (≠ S83), S124 (= S121), S125 (= S122), S126 (= S123), Y150 (= Y147), K154 (= K151), Y178 (= Y174), P181 (≠ A177)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V85), S126 (= S123), Y150 (= Y147), N180 (= N176), S199 (≠ T194), N200 (≠ H195), L201 (= L196), Q217 (≠ K212), V218 (≠ I213), F219 (= F214), R232 (= R227), Y234 (= Y229), V270 (= V265), R293 (= R288), D296 (= D291)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
42% identity, 98% coverage: 9:331/331 of query aligns to 3:340/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), N36 (≠ T42), D62 (= D57), L63 (= L58), F84 (= F79), A85 (≠ S80), G86 (≠ A81), K88 (≠ S83), N103 (= N98), S126 (= S121), S128 (= S123), Y152 (= Y147), K156 (= K151), Y180 (= Y174), P183 (≠ A177)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N176), N202 (≠ H195), L203 (= L196), T219 (≠ K212), Y221 (≠ F214), R234 (= R227), Y236 (= Y229), V275 (= V265), R298 (= R288), D301 (= D291)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
42% identity, 98% coverage: 9:331/331 of query aligns to 3:340/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G14), G11 (= G17), Y12 (= Y18), I13 (= I19), D32 (= D38), N33 (= N39), N36 (≠ T42), D62 (= D57), L63 (= L58), F84 (= F79), A85 (≠ S80), G86 (≠ A81), K88 (≠ S83), N103 (= N98), S126 (= S121), S128 (= S123), Y152 (= Y147), K156 (= K151), Y180 (= Y174), P183 (≠ A177)
- binding uridine-5'-diphosphate-glucose: S128 (= S123), A129 (= A124), F181 (= F175), N182 (= N176), N202 (≠ H195), L203 (= L196), T219 (≠ K212), V220 (≠ I213), Y221 (≠ F214), R234 (= R227), Y236 (= Y229), V275 (= V265), R298 (= R288), D301 (= D291)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
43% identity, 97% coverage: 9:330/331 of query aligns to 6:337/340 of 3enkA
- active site: S127 (= S122), S128 (= S123), T130 (≠ A125), Y152 (= Y147), K156 (= K151)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), G14 (= G17), Y15 (= Y18), I16 (= I19), D35 (= D38), N36 (= N39), V38 (≠ S41), N39 (≠ T42), S40 (≠ G43), D62 (= D57), V63 (≠ L58), F84 (= F79), A85 (≠ S80), A86 (= A81), K88 (≠ S83), N103 (= N98), S126 (= S121), S128 (= S123), Y152 (= Y147), K156 (= K151), Y180 (= Y174), P183 (≠ A177)
- binding uridine-5'-diphosphate-glucose: T130 (≠ A125), N182 (= N176), N201 (≠ T194), N202 (≠ H195), L203 (= L196), R219 (≠ K212), V220 (≠ I213), F221 (= F214), R234 (= R227), Y236 (= Y229), V272 (= V265), R295 (= R288), D298 (= D291)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
41% identity, 96% coverage: 10:328/331 of query aligns to 3:331/338 of 2udpA
- active site: S124 (= S123), A125 (= A124), T126 (≠ A125), Y149 (= Y147), K153 (= K151), M189 (≠ I186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), Y11 (= Y18), I12 (= I19), D31 (= D38), N32 (= N39), L33 (= L40), C34 (≠ S41), N35 (≠ T42), S36 (≠ G43), D58 (= D57), I59 (≠ L58), F80 (= F79), A81 (≠ S80), G82 (≠ A81), K84 (≠ S83), S122 (= S121), S124 (= S123), Y149 (= Y147), K153 (= K151), Y177 (= Y174)
- binding phenyl-uridine-5'-diphosphate: N179 (= N176), N199 (≠ H195), L200 (= L196), A216 (≠ K212), I217 (= I213), F218 (= F214), R231 (= R227), Y233 (= Y229), V269 (= V265), R292 (= R288), D295 (= D291)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
41% identity, 96% coverage: 10:328/331 of query aligns to 3:331/338 of 1udcA
- active site: S124 (= S123), A125 (= A124), T126 (≠ A125), Y149 (= Y147), K153 (= K151), M189 (≠ I186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), Y11 (= Y18), I12 (= I19), D31 (= D38), N32 (= N39), C34 (≠ S41), N35 (≠ T42), S36 (≠ G43), D58 (= D57), I59 (≠ L58), F80 (= F79), A81 (≠ S80), G82 (≠ A81), K84 (≠ S83), S122 (= S121), Y149 (= Y147), K153 (= K151), Y177 (= Y174), P180 (≠ A177)
- binding uridine-5'-diphosphate-mannose: T126 (≠ A125), Y149 (= Y147), N179 (= N176), N199 (≠ H195), L200 (= L196), L215 (= L211), A216 (≠ K212), I217 (= I213), F218 (= F214), R231 (= R227), Y233 (= Y229), V269 (= V265), R292 (= R288)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
41% identity, 96% coverage: 10:328/331 of query aligns to 3:331/338 of P09147
- YI 11:12 (= YI 18:19) binding
- DNLCNS 31:36 (≠ DNLSTG 38:43) binding
- DI 58:59 (≠ DL 57:58) binding
- FAGLK 80:84 (≠ FSAKS 79:83) binding
- N99 (= N98) binding
- S124 (= S123) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y147) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K151) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F175) binding
- Y299 (≠ L295) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
41% identity, 96% coverage: 10:328/331 of query aligns to 3:331/338 of 1udaA
- active site: S124 (= S123), A125 (= A124), T126 (≠ A125), Y149 (= Y147), K153 (= K151), M189 (≠ I186)
- binding nicotinamide-adenine-dinucleotide: G7 (= G14), G10 (= G17), Y11 (= Y18), I12 (= I19), D31 (= D38), N32 (= N39), L33 (= L40), C34 (≠ S41), N35 (≠ T42), S36 (≠ G43), D58 (= D57), I59 (≠ L58), F80 (= F79), A81 (≠ S80), G82 (≠ A81), K84 (≠ S83), S122 (= S121), Y149 (= Y147), K153 (= K151), Y177 (= Y174), P180 (≠ A177)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ A125), N179 (= N176), N199 (≠ H195), L200 (= L196), A216 (≠ K212), I217 (= I213), F218 (= F214), R231 (= R227), Y233 (= Y229), R292 (= R288), D295 (= D291), Y299 (≠ L295)
Query Sequence
>206802 MicrobesOnline__882:206802
MTVSGCCSNVLVCGGAGYIGSHMVRALVEHGYVPIIFDNLSTGHAESVGDVDLVRGDLLD
RQALRRLFAEHSFDAVMHFSAKSLVGESMTDPGIYFVNNVVGTINLLEAMREAGVSRLVF
SSSAAVFGNPLTARIAEDHPRQPVNPYGRSKLMIEQALRDYANAYGMRSVSLRYFNAAGA
DEAGDIGESHKPETHLIPNVLRAALGTGPELKIFGDDYDTPDGTCVRDYIHVADLCDAHL
RALSYMQLKPGAHAFNLGNGNGFSVKQVVEAAWRVTGRDVPHSMAPRRPGDPAWLVADST
LAERELGWKPSFTDIDAIIDSAWRWHQKPRY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory