SitesBLAST
Comparing 206818 MicrobesOnline__882:206818 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
48% identity, 99% coverage: 4:561/563 of query aligns to 92:655/664 of P09114
- P191 (= P103) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W481) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
48% identity, 99% coverage: 4:561/563 of query aligns to 95:658/667 of P09342
- C161 (= C70) modified: Disulfide link with 307
- P194 (= P103) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ V214) modified: Disulfide link with 161
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
47% identity, 99% coverage: 4:561/563 of query aligns to 98:661/670 of P17597
- A122 (= A28) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ I30) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E50) binding
- S186 (= S92) binding
- P197 (= P103) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ P105) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q113) binding
- K220 (= K126) binding
- R246 (= R152) binding ; binding
- K256 (= K162) binding
- G308 (= G212) binding
- TL 331:332 (= TL 237:238) binding
- C340 (≠ G246) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 255:258) binding
- GVRFD 371:375 (≠ GARFD 277:281) binding
- DR 376:377 (= DR 282:283) binding
- DI 395:396 (= DI 301:302) binding
- DV 414:415 (≠ DC 320:321) binding
- QH 487:488 (≠ QN 394:395) binding
- GG 508:509 (= GG 415:416) binding
- GAM 511:513 (≠ GTM 418:420) binding
- D538 (= D445) binding
- DGS 538:540 (= DGS 445:447) binding
- N565 (= N472) binding
- NQHLGM 565:570 (≠ NGYLGM 472:477) binding
- H567 (≠ Y474) binding
- W574 (= W481) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ A553) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/585 of 5k2oA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M257), R292 (= R283), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), G286 (= G277), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), Q404 (= Q396), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), R292 (= R283), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415)
- binding magnesium ion: F370 (= F363), D453 (= D445), M458 (= M450), Q461 (= Q453), N480 (= N472), H482 (≠ Y474), K533 (≠ V518)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M257), R292 (= R283), M485 (= M477), W489 (= W481), S568 (≠ A553)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 5wj1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (= L255), G286 (= G277), R288 (= R279), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M257), D291 (= D282), R292 (= R283), M485 (= M477), W489 (= W481), S568 (≠ A553)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 5k6tA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H258), R292 (= R283), M485 (= M477), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), G286 (= G277), R288 (= R279), D290 (= D281), R292 (= R283), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), Q404 (= Q396), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), G452 (= G444), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 5k6rA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R283), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), M266 (= M257), G286 (= G277), R288 (= R279), R292 (= R283), V293 (= V284), D310 (= D301), I311 (= I302), G328 (= G319), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), M458 (= M450), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1z8nA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K126), R161 (= R152), Y191 (= Y182), R194 (vs. gap), D291 (= D282), R292 (= R283), D312 (= D303), W489 (= W481), G569 (= G554)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), G265 (= G256), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), R292 (= R283), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472)
- binding thiamine diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), G452 (= G444), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1yi1A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D282), R292 (= R283), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (= L255), G265 (= G256), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1yi0A
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D282), R292 (= R283), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), G265 (= G256), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), R292 (= R283), V293 (= V284), D310 (= D301), I311 (= I302), G328 (= G319), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1yhzA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D282), R292 (= R283), M485 (= M477), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1yhyA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D282), R292 (= R283), V486 (= V478), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), G265 (= G256), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 1ybhA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M257), D291 (= D282), R292 (= R283), M485 (= M477), W489 (= W481), S568 (≠ A553)
- binding flavin-adenine dinucleotide: R161 (= R152), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), M266 (= M257), H267 (= H258), G286 (= G277), V287 (≠ A278), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), Q404 (= Q396), M405 (= M397), G423 (= G415), G424 (= G416)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/583 of 5k3sA
- active site: Y33 (= Y24), G35 (= G26), G36 (= G27), A37 (= A28), S38 (≠ V29), E59 (= E50), T82 (= T73), F121 (= F112), Q122 (= Q113), E123 (= E114), K171 (= K162), M266 (= M257), V293 (= V284), V400 (= V392), G426 (= G418), M428 (= M420), D453 (= D445), N480 (= N472), H482 (≠ Y474), L483 (= L475), M485 (= M477), V486 (= V478), W489 (= W481), H558 (≠ R543)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R283), M485 (= M477), W489 (= W481), G569 (= G554)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), L264 (= L255), M266 (= M257), G286 (= G277), R288 (= R279), D290 (= D281), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415)
- binding magnesium ion: D453 (= D445), N480 (= N472), H482 (≠ Y474)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), D453 (= D445), G454 (= G446), S455 (= S447), N480 (= N472), H482 (≠ Y474), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 12:575/582 of 3ea4A
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E50), T81 (= T73), F120 (= F112), Q121 (= Q113), E122 (= E114), K170 (= K162), M265 (= M257), V292 (= V284), V399 (= V392), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ Y474), L482 (= L475), M484 (= M477), V485 (= V478), W488 (= W481), H557 (≠ R543)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D282), R291 (= R283), W488 (= W481), S567 (≠ A553)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R152), G221 (= G211), G222 (= G212), G223 (= G213), T245 (= T237), L246 (= L238), M247 (= M239), L263 (= L255), G264 (= G256), M265 (= M257), H266 (= H258), G285 (= G277), R287 (= R279), D289 (= D281), R291 (= R283), D309 (= D301), I310 (= I302), G327 (= G319), D328 (= D320), V329 (≠ C321), M404 (= M397), G422 (= G415)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ Y474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V392), G400 (= G393), Q401 (= Q394), H402 (≠ N395), M427 (= M420), G451 (= G444), D452 (= D445), G453 (= G446), S454 (= S447), N479 (= N472), H481 (≠ Y474), L482 (= L475), G483 (= G476), M484 (= M477), V485 (= V478)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 12:575/582 of 3e9yA
- active site: Y32 (= Y24), G34 (= G26), G35 (= G27), A36 (= A28), S37 (≠ V29), E58 (= E50), T81 (= T73), F120 (= F112), Q121 (= Q113), E122 (= E114), K170 (= K162), M265 (= M257), V292 (= V284), V399 (= V392), G425 (= G418), M427 (= M420), D452 (= D445), N479 (= N472), H481 (≠ Y474), L482 (= L475), M484 (= M477), V485 (= V478), W488 (= W481), H557 (≠ R543)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D282), R291 (= R283), W488 (= W481), S567 (≠ A553)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R152), G221 (= G211), G222 (= G212), G223 (= G213), T245 (= T237), L246 (= L238), M247 (= M239), L263 (= L255), G285 (= G277), R287 (= R279), D289 (= D281), R291 (= R283), D309 (= D301), I310 (= I302), G327 (= G319), D328 (= D320), V329 (≠ C321), M404 (= M397), G422 (= G415)
- binding magnesium ion: D452 (= D445), N479 (= N472), H481 (≠ Y474)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V392), G400 (= G393), Q401 (= Q394), H402 (≠ N395), M427 (= M420), G451 (= G444), G453 (= G446), S454 (= S447), N479 (= N472), H481 (≠ Y474), L482 (= L475), G483 (= G476), M484 (= M477), V485 (= V478)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
47% identity, 99% coverage: 4:561/563 of query aligns to 13:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M257), R292 (= R283), W489 (= W481), S568 (≠ A553)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V392), G401 (= G393), Q402 (= Q394), H403 (≠ N395), G426 (= G418), M428 (= M420), G452 (= G444), D453 (= D445), G454 (= G446), S455 (= S447), L483 (= L475), G484 (= G476), M485 (= M477), V486 (= V478)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G211), G223 (= G212), G224 (= G213), T246 (= T237), L247 (= L238), M248 (= M239), M263 (= M254), L264 (= L255), M266 (= M257), H267 (= H258), G286 (= G277), R288 (= R279), V293 (= V284), D310 (= D301), I311 (= I302), D329 (= D320), V330 (≠ C321), M405 (= M397), G423 (= G415)
- binding magnesium ion: A37 (= A28), T82 (= T73), S83 (= S74), Q122 (= Q113), Y381 (≠ Q373), D453 (= D445), M458 (= M450), Q461 (= Q453), N480 (= N472), H482 (≠ Y474), K533 (≠ V518)
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
48% identity, 99% coverage: 3:561/563 of query aligns to 8:574/596 of 1t9cA
- active site: Y29 (= Y24), G31 (= G26), G32 (= G27), A33 (= A28), I34 (≠ V29), E55 (= E50), T78 (= T73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (= K162), R227 (≠ E221), M263 (= M257), V290 (= V284), V406 (= V392), L431 (= L417), G432 (= G418), M434 (= M420), D459 (= D445), N486 (= N472), E488 (≠ Y474), Q489 (≠ L475), M491 (= M477), V492 (= V478), W495 (= W481), L517 (= L504), G522 (= G509), L523 (≠ A510), K556 (≠ R543)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G27), V107 (= V102), P108 (= P103), F117 (= F112), K167 (= K162), D288 (= D282), R289 (= R283), W495 (= W481)
- binding flavin-adenine dinucleotide: R157 (= R152), G216 (= G211), A217 (≠ G212), G218 (= G213), N221 (vs. gap), T243 (= T237), L244 (= L238), Q245 (≠ M239), L261 (= L255), M263 (= M257), H264 (= H258), G283 (= G277), A284 (= A278), R285 (= R279), D287 (= D281), R289 (= R283), V290 (= V284), E316 (≠ D301), V317 (≠ I302), N321 (≠ S306), G334 (= G319), D335 (= D320), A336 (≠ C321), M411 (= M397), G429 (= G415), G430 (= G416)
- binding magnesium ion: D459 (= D445), N486 (= N472), E488 (≠ Y474)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
48% identity, 99% coverage: 3:561/563 of query aligns to 8:574/596 of 1t9dA
- active site: Y29 (= Y24), G31 (= G26), G32 (= G27), A33 (= A28), I34 (≠ V29), E55 (= E50), T78 (= T73), F117 (= F112), Q118 (= Q113), E119 (= E114), K167 (= K162), R227 (≠ E221), M263 (= M257), V290 (= V284), V406 (= V392), L431 (= L417), G432 (= G418), M434 (= M420), D459 (= D445), N486 (= N472), E488 (≠ Y474), Q489 (≠ L475), M491 (= M477), V492 (= V478), W495 (= W481), L517 (= L504), G522 (= G509), L523 (≠ A510), K556 (≠ R543)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G27), A33 (= A28), V107 (= V102), P108 (= P103), F117 (= F112), K167 (= K162), M263 (= M257), D288 (= D282), R289 (= R283), W495 (= W481)
- binding flavin-adenine dinucleotide: R157 (= R152), G216 (= G211), A217 (≠ G212), G218 (= G213), N221 (vs. gap), T243 (= T237), L244 (= L238), Q245 (≠ M239), M260 (= M254), L261 (= L255), H264 (= H258), G283 (= G277), A284 (= A278), R285 (= R279), D287 (= D281), R289 (= R283), V290 (= V284), E316 (≠ D301), V317 (≠ I302), N321 (≠ S306), G334 (= G319), D335 (= D320), A336 (≠ C321), Q410 (= Q396), M411 (= M397), G429 (= G415), G430 (= G416)
- binding magnesium ion: D459 (= D445), N486 (= N472), E488 (≠ Y474)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E50), P81 (= P76), Q118 (= Q113), G432 (= G418), M434 (= M420), M464 (= M450)
Query Sequence
>206818 MicrobesOnline__882:206818
MQLNGAQILLECLKKEGVDVFFGYPGGAVIDIYDEIPRHPELHHVLVRHEQAAVHAADGY
ARASGKVGVCLVTSGPGATNTVTGIATAYSDSIPVVILTGQVPTPLIGNDAFQEVDIVGI
TRPCTKHNYLVRDVKELATVVRQAFYLARTGRPGPVLVDLPKDVMQAKTDFVWPEDVSMR
SYNPTYKPNLNQIRRAADAFFEAERPLLFVGGGVVMSDASEELGWFARTLRIPVASTLMG
LGAFPGDDPLWLGMLGMHGTYAANKAVNNADLIVAVGARFDDRVTGRLSAFASKARIIHI
DIDPTSIRKNVQVGIPVVGDCRQSLANIREILVPRLEEKDWGAAHARWLEQLASWRVEQP
LGFSREGGIKPQQVIEQLFAITRGDAIITTEVGQNQMWTAQFYTFRKPRTLITSGGLGTM
GYGFPAAIGAQFAFPDKLVVDVAGDGSIQMNIQELATAVCNKLPVKILILNNGYLGMVRQ
WQELFYQRNYCSTCMDAQPDFVKLAEAYGAEGYRITEVESLESTLREALASPHPAIIDVR
VEREENVYPMVPAGAALDEMLLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory