SitesBLAST
Comparing 207007 MicrobesOnline__882:207007 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
69% identity, 100% coverage: 1:903/906 of query aligns to 1:905/906 of 1dgjA
- active site: V391 (≠ I390), F427 (= F425), R503 (= R501), Y507 (≠ F505), R535 (= R533), E869 (= E867), M870 (≠ L868)
- binding molybdenum (iv)oxide: G424 (= G422), R535 (= R533), G698 (= G696), E869 (= E867)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), G39 (= G39), C40 (= C40), G41 (= G41), G43 (= G43), Q44 (≠ H44), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding pterin cytosine dinucleotide: Q99 (= Q99), C139 (= C139), F423 (= F421), G424 (= G422), R535 (= R533), W652 (= W650), H655 (= H653), G656 (= G654), Q657 (= Q655), G658 (= G656), A697 (= A695), G698 (= G696), S700 (= S698), S702 (= S700), Q703 (= Q701), C799 (≠ V797), N800 (= N798), V803 (≠ T801), V804 (= V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
4usaA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with trans-cinnamaldehyde (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 4usaA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding bicarbonate ion: R460 (= R460), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding hydrocinnamic acid: I255 (= I255), F425 (= F425), F494 (= F494), L497 (= L497), Y535 (= Y535), L626 (= L626)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
4us9A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with 3- phenylpropionaldehyde (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 4us9A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding 3-phenylpropanal: I255 (= I255), F257 (= F257), P258 (= P258), H752 (≠ D751)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539), R890 (= R888), Y892 (≠ T890)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
4us8A Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with benzaldehyde (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 4us8A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), F532 (= F532), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding benzaldehyde: I255 (= I255), I255 (= I255), L394 (= L394), F425 (= F425), F425 (= F425), F425 (= F425), F425 (= F425), L497 (= L497), L497 (= L497), R501 (= R501), A531 (= A531), Y535 (= Y535), Y535 (= Y535), L626 (= L626), L626 (= L626), L626 (= L626), P694 (= P694), G696 (= G696), G697 (= G697)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), G697 (= G697), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
4c7yA Aldehyde oxidoreductase from desulfovibrio gigas (mop), soaked with sodium dithionite and sodium sulfide (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 4c7yA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding bicarbonate ion: R460 (= R460), L498 (= L498), A531 (= A531), Y535 (= Y535), Q539 (= Q539)
- binding fe2/s2 (inorganic) cluster: C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
- binding hydrogen peroxide: G696 (= G696), G697 (= G697), E869 (= E867)
3fc4A Ethylene glycol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 3fc4A
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding 1,2-ethanediol: Y535 (= Y535), Y622 (= Y622), G696 (= G696), G697 (= G697), E869 (= E867)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
3fahA Glycerol inhibited form of aldehyde oxidoreductase from desulfovibrio gigas (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 3fahA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding glycerol: P416 (= P416), Y535 (= Y535), Y622 (= Y622), W683 (≠ L683), G696 (= G696), G697 (= G697), E869 (= E867), K884 (≠ H882), V889 (= V887), R890 (= R888), Y892 (≠ T890)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), G419 (= G419), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), W650 (= W650), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
1sijA Crystal structure of the aldehyde dehydrogenase (a.K.A. Aor or mop) of desulfovibrio gigas covalently bound to [aso3]- (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of 1sijA
- active site: I390 (= I390), F425 (= F425), R501 (= R501), F505 (= F505), R533 (= R533), E869 (= E867), L870 (= L868)
- binding arsenite: Y535 (= Y535), G696 (= G696), G697 (= G697), E869 (= E867)
- binding fe2/s2 (inorganic) cluster: V38 (= V38), C40 (= C40), E41 (≠ G41), G43 (= G43), C45 (= C45), G46 (= G46), C48 (= C48), R58 (= R58), C60 (= C60), Q99 (= Q99), C100 (= C100), G101 (= G101), C103 (= C103), C137 (= C137), C139 (= C139)
- binding magnesium ion: E899 (= E897), E903 (≠ A901)
- binding (molybdopterin-cytosine dinucleotide-s,s)-dioxo-aqua-molybdenum(v): Q99 (= Q99), C139 (= C139), T420 (= T420), F421 (= F421), G422 (= G422), R533 (= R533), H653 (= H653), G654 (= G654), Q655 (= Q655), G656 (= G656), S695 (≠ A695), G696 (= G696), S698 (= S698), Q700 (≠ S700), Q701 (= Q701), C799 (≠ V797), N800 (= N798), T804 (≠ V802), Q807 (= Q805), S865 (≠ G863), G866 (= G864), V867 (= V865), G868 (= G866), E869 (= E867)
Q46509 Aldehyde oxidoreductase; Molybdenum iron sulfur protein; EC 1.2.99.7 from Megalodesulfovibrio gigas (Desulfovibrio gigas) (see paper)
70% identity, 100% coverage: 1:904/906 of query aligns to 1:906/907 of Q46509
- C40 (= C40) binding
- C45 (= C45) binding
- C48 (= C48) binding
- C60 (= C60) binding
- C100 (= C100) binding
- C103 (= C103) binding
- C137 (= C137) binding
- C139 (= C139) binding
3b9jC Structure of xanthine oxidase with 2-hydroxy-6-methylpurine (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/758 of 3b9jC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding 6-methyl-3,9-dihydro-2H-purin-2-one: E232 (vs. gap), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), A509 (≠ G697), E691 (= E867)
- binding calcium ion: R269 (= R460), H270 (≠ S461)
3nvyC Crystal structure of bovine xanthine oxidase in complex with quercetin (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/756 of 3nvyC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding 3,5,7,3',4'-pentahydroxyflavone: L78 (= L254), E232 (vs. gap), L303 (≠ F494), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), L444 (vs. gap), A509 (≠ G697)
3nvwC Crystal structure of bovine xanthine oxidase in complex with guanine (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/756 of 3nvwC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding guanine: E232 (vs. gap), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), L444 (vs. gap)
3eub4 Crystal structure of desulfo-xanthine oxidase with xanthine (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/756 of 3eub4
- active site: H314 (≠ F505), R342 (= R533), E691 (= E867)
- binding hydroxy(dioxo)molybdenum: G229 (= G422), F341 (= F532), R342 (= R533), A508 (≠ G696), A509 (≠ G697), E691 (= E867)
- binding xanthine: E232 (vs. gap), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), A509 (≠ G697)
3nvzC Crystal structure of bovine xanthine oxidase in complex with indole-3- aldehyde (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/755 of 3nvzC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding 1h-indole-3-carbaldehyde: E232 (vs. gap), L303 (≠ F494), S306 (≠ L497), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), V441 (≠ G628), L444 (vs. gap)
3nvvC Crystal structure of bovine xanthine oxidase in complex with arsenite (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/755 of 3nvvC
3ns1C Crystal structure of bovine xanthine oxidase in complex with 6- mercaptopurine (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/755 of 3ns1C
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding 9H-purine-6-thiol: E232 (vs. gap), R310 (= R501), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627)
3etrC Crystal structure of xanthine oxidase in complex with lumazine (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/755 of 3etrC
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding calcium ion: R269 (= R460), H270 (≠ S461), I307 (≠ L498)
- binding pteridine-2,4(1H,3H)-dione: L303 (≠ F494), F344 (≠ Y535), F439 (≠ L626), T440 (≠ D627), V441 (≠ G628), L444 (vs. gap), A509 (≠ G697)
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
27% identity, 80% coverage: 173:899/906 of query aligns to 469:1204/1225 of 3ax7A
- active site: Q666 (≠ I390), E701 (vs. gap), R779 (= R501), H783 (≠ F505), R811 (= R533), G1159 (= G866), E1160 (= E867)
- binding bicarbonate ion: R738 (= R460), H739 (≠ S461), I776 (≠ L498), T808 (≠ S530), A809 (= A531), G814 (= G536), Q817 (= Q539)
- binding calcium ion: A766 (≠ H488), S769 (≠ Y491), R770 (≠ S492), S773 (≠ G495), S806 (≠ W528), N807 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L643 (≠ I368)
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: G695 (= G419), G696 (≠ T420), F697 (= F421), G698 (= G422), F810 (= F532), R811 (= R533), M937 (≠ H653), G938 (= G654), Q939 (= Q655), A977 (≠ G696), A978 (≠ G697), S979 (= S698), S981 (= S700), Q1093 (= Q805), E1160 (= E867)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 45, 197, 198, 199, 200, 201, 202, 203, 204, 205, 278, 279, 283, 287, 288, 291, 292, 294, 295, 300, 301, 345
- binding fe2/s2 (inorganic) cluster: 41, 42, 43, 45, 47, 48, 50, 70, 72, 112, 113, 115, 147, 149
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 111, 149
3sr6C Crystal structure of reduced bovine xanthine oxidase in complex with arsenite (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 4:735/745 of 3sr6C
- active site: Q197 (≠ I390), E232 (vs. gap), R310 (= R501), H314 (≠ F505), R342 (= R533), G690 (= G866), E691 (= E867)
- binding [arsenothionito(2-)-kappa~2~O,S](oxo)molybdenum: G229 (= G422), F344 (≠ Y535), A508 (≠ G696), A509 (≠ G697), E691 (= E867)
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
27% identity, 80% coverage: 177:899/906 of query aligns to 541:1272/1299 of 1vdvA
- active site: Q734 (≠ I390), E769 (vs. gap), R847 (= R501), H851 (≠ F505), R879 (= R533), G1227 (= G866), E1228 (= E867)
- binding calcium ion: H708 (= H365), Y710 (≠ P367), T803 (= T457), G804 (= G458), A834 (≠ H488), S837 (≠ Y491), R838 (≠ S492), S841 (≠ G495), S874 (≠ W528), N875 (≠ G529)
- binding fe2/s2 (inorganic) cluster: L711 (≠ I368)
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: E769 (vs. gap), L840 (≠ F494), S843 (≠ L497), R847 (= R501), F881 (≠ Y535), F976 (≠ L626), T977 (≠ D627), V978 (≠ G628), L981 (vs. gap), P1043 (= P694), A1046 (≠ G697)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 43, 44, 229, 230, 231, 232, 233, 234, 235, 236, 309, 310, 318, 319, 322, 323, 325, 326, 331, 332, 375, 376
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148
Query Sequence
>207007 MicrobesOnline__882:207007
MIKRMVTINGAPRMAITRPDTTLATYLRESLGLTSVKVGCGQGHCGSCNVIVDGKLVRSC
SYKMSRLTEGATITTLEGIGTPDNLHPLQVAWMAHGAAQCGFCSPGFIVSAKALIDTNPK
PSRDDVRDWFQKHRNACRCTGYKPLVDAVMDAAAVVRGEMKVDDLLYRIPADGRIWGTKY
PRPSALAKVTGTLDFGADLGIKMPEETLRCALVQAEASHAKILGIDTSEAEKMPGVFKVV
THKDIKGKNRITGLITFPSNKGDGWDRPILCDEKVFQYGDAIAIVCADTEEHAKAAAAAV
KVDLEVLPAYMSAPAAMADDAMEIHPGTPNVYFEQHLVKGPETKPIFDKADVVVEDDFYV
GRQPHMPIEPDVGFAFFNEDGKLCIHSKSIGLHLHLYMIAPGLGIEPDNIIMVQNPTGGT
FGYKFSPTMEALVGAAAMATGRPVFLNYSWYQQQTYTGKRSPFFINLRYAATREGKLLAM
ESDWSVDHGPYSEFGDLLTLRGAQFIGAGYDIPSIRGLGRTVCTNHAWGSAFRGYGSPQS
EFASEVLMDELAEKLGIDPLELRYRNVYREGATTPTGQVPEVLSLPELLDTARPRYLAAK
EKAARESTAEVKKGVGISVGVYGCGLDGPDTAEIAVELNEDGTVTIFATWHDHGQGADMG
TLGTAHEALRPLGIAPENIRLVLNDTAVCPNAGPAGGSRSQVVVGRAIKAGCELLLGGMR
KADGTFRTYAEMRDEKIATRYSGKWSAPCTDCNAEGQGSPFAVYMYGVFLAEVSVELATG
KTTVDKMTLVADIGKIVNRLTVDGQLYGGIAQGIGLALSEDFEDIKKHSTMPGAGFPYIK
QIPDEIDLVYVEVPRPEGPFGAGGVGELPLTCPHAAIINAIHNACGVRVTRLPALPEKVL
AGLQGK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory