SitesBLAST
Comparing 207025 MicrobesOnline__882:207025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q63XL8 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Burkholderia pseudomallei (strain K96243) (see paper)
55% identity, 98% coverage: 5:311/312 of query aligns to 7:315/318 of Q63XL8
6asvC E. Coli prpp synthetase (see paper)
53% identity, 99% coverage: 4:311/312 of query aligns to 1:311/311 of 6asvC
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
53% identity, 99% coverage: 4:311/312 of query aligns to 3:313/315 of P0A717
- D129 (= D129) to A: in mutant PRSA1; alters the binding of divalent cations, especially magnesium. Little alteration in the affinity for ribose 5-phosphate and 27-fold decrease of the affinity for ATP. Absence of inhibition by AMP
- D220 (= D218) mutation to E: 4-fold decrease in the affinity binding for Rib-5-P in the presence of magnesium ions. In the presence of cobalt ions, it shows a 15-fold decrease in the affinity binding for Rib-5-P.; mutation to F: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
- D221 (= D219) mutation to A: The affinity binding for ATP is comparable to those of the wild-type, apart from a slight decrease in the presence of manganese ions. The affinity binding for Rib-5-P is greatly decreased in the presence of both manganese and cobalt ions but only about 2-fold in the presence of magnesium ions.
- D224 (= D222) mutation to A: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.; mutation to S: With magnesium or manganese ions, the affinity binding values for ATP and Rib-5-P are comparable to those of the wild-type.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
53% identity, 97% coverage: 4:307/312 of query aligns to 2:308/308 of 4s2uA
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
53% identity, 99% coverage: 4:311/312 of query aligns to 1:305/307 of 7xmvA
- binding adenosine-5'-diphosphate: F33 (= F36), D35 (= D38), E37 (= E40), R94 (= R97), R97 (= R100), H129 (= H131)
- binding adenosine monophosphate: R97 (= R100), V99 (= V102), R100 (vs. gap), E131 (≠ G133), F145 (≠ Y147), S147 (≠ A149), V173 (≠ E174), A177 (= A178)
- binding 5-O-phosphono-alpha-D-ribofuranose: D212 (= D218), D213 (= D219), M214 (= M220), D216 (= D222), T217 (= T223), G219 (= G225), T220 (= T226)
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
53% identity, 99% coverage: 4:311/312 of query aligns to 1:305/307 of 7xmuA
- binding adenosine-5'-diphosphate: F33 (= F36), D35 (= D38), E37 (= E40), R94 (= R97), Q95 (= Q98), R97 (= R100), R97 (= R100), R100 (vs. gap), H129 (= H131), E131 (≠ G133), F145 (≠ Y147), S147 (≠ A149), V173 (≠ E174)
- binding 5-O-phosphono-alpha-D-ribofuranose: D168 (= D169), D212 (= D218), M214 (= M220), D216 (= D222), T217 (= T223)
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
56% identity, 96% coverage: 5:302/312 of query aligns to 3:298/299 of 6nfeB
- binding adenosine-5'-diphosphate: F34 (= F36), D36 (= D38), E38 (= E40), R95 (= R97), Q96 (= Q98), H130 (= H131)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H131), D214 (= D218), D215 (= D219), I216 (≠ M220), D218 (= D222), T219 (= T223), A220 (= A224), T222 (= T226)
3dahC 2.3 a crystal structure of ribose-phosphate pyrophosphokinase from burkholderia pseudomallei (see paper)
54% identity, 97% coverage: 5:307/312 of query aligns to 2:299/300 of 3dahC
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
56% identity, 96% coverage: 5:302/312 of query aligns to 3:297/298 of 6nfeA
- binding adenosine-5'-diphosphate: F34 (= F36), D36 (= D38), E38 (= E40), R95 (= R97), Q96 (= Q98), H130 (= H131)
- binding adenosine monophosphate: R98 (= R100), V100 (= V102), Y146 (= Y147), R175 (= R175), A178 (= A178), K181 (= K181)
- binding 5-O-phosphono-alpha-D-ribofuranose: H130 (= H131), D213 (= D218), D214 (= D219), I215 (≠ M220), D217 (= D222), T218 (= T223), A219 (= A224), T221 (= T226)
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
51% identity, 99% coverage: 4:311/312 of query aligns to 9:316/317 of P14193
- RQ 102:103 (= RQ 97:98) binding
- K198 (= K192) mutation to A: Strong decrease of the Vmax value compared to that of the wild-type. The affinity binding for ATP and Rib-5-P are slightly altered compared to the wild-type. The cooperativity of ADP binding is reduced.
- R200 (= R194) mutation to A: Strong decrease of the Vmax value compared to that of the wild-type enzyme. The affinity binding for ATP and Rib-5-P are slightly altered compared to the wild-type.
- R202 (≠ K196) mutation to A: 3-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- N204 (= N198) mutation to A: 4.5-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- E207 (≠ Q201) mutation to A: 2.5-fold decrease in the affinity binding for ATP. Slight decrease of the Vmax value.
- DTAGT 228:232 (= DTAGT 222:226) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8dbkB Human prps1 with phosphate, atp, and r5p; hexamer with resolved catalytic loops (see paper)
49% identity, 99% coverage: 4:311/312 of query aligns to 2:312/316 of 8dbkB
- binding adenosine monophosphate: R95 (= R97), Q96 (= Q98), N199 (= N198)
- binding adenosine-5'-triphosphate: F34 (= F36), N36 (≠ D38), E38 (= E40)
- binding phosphate ion: S46 (≠ N48), R48 (= R50)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: H129 (= H131), D170 (= D169), G172 (= G171), K193 (= K192), R195 (= R194), D219 (= D218), D220 (= D219), D223 (= D222), T224 (= T223), C225 (≠ A224), G226 (= G225), T227 (= T226)
8dbeA Human prps1 with adp; hexamer (see paper)
49% identity, 99% coverage: 4:311/312 of query aligns to 2:312/316 of 8dbeA
- binding adenosine-5'-diphosphate: F34 (= F36), N36 (≠ D38), E38 (= E40), R95 (= R97), Q96 (= Q98), K98 (≠ R100), K99 (= K101), D100 (≠ V102), S102 (≠ P104), R103 (= R105), H129 (= H131), D142 (= D144), Y145 (= Y147), S307 (= S306), V308 (= V307), S309 (= S308), F312 (= F311)
- binding 5-O-phosphono-alpha-D-ribofuranose: H129 (= H131), D170 (= D169), D219 (= D218), D220 (= D219), D223 (= D222), T224 (= T223), G226 (= G225), T227 (= T226)
P60891 Ribose-phosphate pyrophosphokinase 1; PPRibP; Phosphoribosyl pyrophosphate synthase I; PRS-I; EC 2.7.6.1 from Homo sapiens (Human) (see 5 papers)
49% identity, 99% coverage: 4:311/312 of query aligns to 3:313/318 of P60891
- S16 (≠ A17) to P: found in patients with phosphoribosyl pyrophosphate synthetase I deficiency; likely pathogenic; dbSNP:rs869025594
- D52 (= D53) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852542
- N114 (≠ D115) to S: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852540
- L129 (= L130) to I: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852543
- S132 (≠ G133) mutation to A: Reduces catalytic activity.; mutation to F: No effect on catalytic activity.
- V142 (= V143) to L: found in a patient with an intermediate phenotype between ARTS and PRPS1 superactivity; likely pathogenic; normal PRPP synthetase activity in fibroblasts; loss of activity in erythrocytes; dbSNP:rs398122855
- N144 (= N145) mutation to H: No effect on catalytic activity.
- Y146 (= Y147) mutation to F: No effect on catalytic activity.; mutation to M: Reduces catalytic activity.
- D183 (≠ K181) to H: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852541
- A190 (= A188) to V: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852544
- H193 (≠ D191) to Q: in PRPS1 superactivity; no effect on Km; resistant to inhibition by ADP and GDP; dbSNP:rs137852545
- D203 (≠ Q201) to H: in a breast cancer sample; somatic mutation
- V219 (= V217) to G: in a breast cancer sample; somatic mutation
- H231 (≠ A229) to D: in a colorectal cancer sample; somatic mutation
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2hcrA Crystal structure of human phosphoribosyl pyrophosphate synthetase 1 in complex with amp(atp), cadmium and sulfate ion (see paper)
49% identity, 99% coverage: 4:311/312 of query aligns to 1:305/305 of 2hcrA
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
50% identity, 99% coverage: 4:311/312 of query aligns to 1:295/295 of 1dkuA
8dbgA Human prps1 with phosphate and atp; hexamer (see paper)
48% identity, 99% coverage: 4:311/312 of query aligns to 2:305/309 of 8dbgA
- binding adenosine-5'-triphosphate: F34 (= F36), N36 (≠ D38), E38 (= E40), R95 (= R97), Q96 (= Q98), K98 (≠ R100), H129 (= H131)
- binding phosphate ion: S46 (≠ N48), R48 (= R50), D216 (= D222), T217 (= T223), C218 (≠ A224), T220 (= T226)
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
50% identity, 99% coverage: 4:311/312 of query aligns to 3:299/299 of 1ibsB
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
50% identity, 99% coverage: 4:311/312 of query aligns to 1:297/297 of 1ibsA
7yk1A Structural basis of human prps2 filaments (see paper)
47% identity, 99% coverage: 4:311/312 of query aligns to 2:303/306 of 7yk1A
- binding adenosine-5'-diphosphate: F34 (= F36), N36 (≠ D38), E38 (= E40), S46 (≠ N48), R48 (= R50), R95 (= R97), K99 (= K101), D100 (≠ V102), K101 (≠ S103), S102 (≠ P104), R103 (= R105), H129 (= H131), D142 (= D144), S298 (= S306), S300 (= S308), F303 (= F311)
- binding phosphate ion: D214 (= D222), C216 (≠ A224), T218 (= T226)
O94413 Ribose-phosphate pyrophosphokinase 2; Phosphoribosyl pyrophosphate synthase 2; EC 2.7.6.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
48% identity, 98% coverage: 5:311/312 of query aligns to 6:316/321 of O94413
- S172 (= S167) modified: Phosphoserine
Query Sequence
>207025 MicrobesOnline__882:207025
MQGDLKILTGTSNPELAKAICNHLGCQITPALCETFSDGEIRIEIGDNVRGDDVFVVQAT
CAPVNFNLMQLFLMLDALKRASAGRVTAVMPYYGYARQDRKVSPRAPISAKLVADFLTTA
GTDRVVTVDLHAGQIQGFFNSPVDNLYAAPVILDYLRQVEGEIVIVSPDAGGVERARAYA
KRLNAGLAIVDKRRDKPNQAQAMHVIGDVRDKVAIVVDDMIDTAGTLCAAGEVLLKNGAR
EVMACATHPVLSGPAIERLCNSPFKQVIVTDTVPLGDKLNACPKLHVLSVAGLLAKAIHN
IHTESSVSVLFV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory