Comparing 207036 MicrobesOnline__882:207036 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8g3hA Structure of cobalamin-dependent methionine synthase (meth) in a resting state (see paper)
32% identity, 98% coverage: 12:801/804 of query aligns to 12:832/841 of 8g3hA
Q99707 Methionine synthase; MS; 5-methyltetrahydrofolate--homocysteine methyltransferase; Cobalamin-dependent methionine synthase; Vitamin-B12 dependent methionine synthase; EC 2.1.1.13 from Homo sapiens (Human) (see 6 papers)
31% identity, 99% coverage: 6:802/804 of query aligns to 23:891/1265 of Q99707
Sites not aligning to the query:
P13009 Methionine synthase; 5-methyltetrahydrofolate--homocysteine methyltransferase; Methionine synthase, vitamin-B12-dependent; MS; EC 2.1.1.13 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 97% coverage: 12:792/804 of query aligns to 15:855/1227 of P13009
Sites not aligning to the query:
1q8jA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima (cd2+, hcy, methyltetrahydrofolate complex) (see paper)
36% identity, 69% coverage: 8:563/804 of query aligns to 10:557/559 of 1q8jA
3bofA Cobalamin-dependent methionine synthase (1-566) from thermotoga maritima complexed with zn2+ and homocysteine (see paper)
36% identity, 69% coverage: 8:563/804 of query aligns to 10:557/560 of 3bofA
4cczA Crystal structure of human 5-methyltetrahydrofolate-homocysteine methyltransferase, the homocysteine and folate binding domains
29% identity, 71% coverage: 6:575/804 of query aligns to 7:610/611 of 4cczA
8sseA Methionine synthase, c-terminal fragment, cobalamin and reactivation domains from thermus thermophilus hb8 (see paper)
35% identity, 26% coverage: 596:801/804 of query aligns to 1:206/507 of 8sseA
Sites not aligning to the query:
7xcnP Crystal structure of the mttb-mttc complex at 2.7 a resolution (see paper)
39% identity, 25% coverage: 602:802/804 of query aligns to 11:214/215 of 7xcnP
4jgiB 1.5 angstrom crystal structure of a novel cobalamin-binding protein from desulfitobacterium hafniense dcb-2 (see paper)
37% identity, 24% coverage: 609:799/804 of query aligns to 15:202/206 of 4jgiB
4djfA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate and ti(iii) citrate reductant (see paper)
32% identity, 32% coverage: 320:574/804 of query aligns to 3:259/262 of 4djfA
4djeA Crystal structure of folate-bound corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr), co-crystallized with folate (see paper)
32% identity, 32% coverage: 320:574/804 of query aligns to 3:259/262 of 4djeA
4djdA Crystal structure of folate-free corrinoid iron-sulfur protein (cfesp) in complex with its methyltransferase (metr) (see paper)
32% identity, 32% coverage: 320:574/804 of query aligns to 3:259/262 of 4djdA
2e7fA 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase complexed with methyltetrahydrofolate to 2.2 angsrom resolution (see paper)
32% identity, 32% coverage: 320:574/804 of query aligns to 3:259/262 of 2e7fA
Q46389 5-methyltetrahydrofolate:corrinoid/iron-sulfur protein co-methyltransferase; 5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase; MeTr; EC 2.1.1.258 from Moorella thermoacetica (Clostridium thermoaceticum) (see 2 papers)
32% identity, 32% coverage: 320:574/804 of query aligns to 3:259/262 of Q46389
1y80A Structure of a corrinoid (factor iiim)-binding protein from moorella thermoacetica
50% identity, 15% coverage: 686:802/804 of query aligns to 7:125/125 of 1y80A
4o1eA Structure of a methyltransferase component in complex with mthf involved in o-demethylation (see paper)
35% identity, 32% coverage: 320:574/804 of query aligns to 7:262/271 of 4o1eA
3ivaA Structure of the b12-dependent methionine synthase (meth) c-teminal half with adohcy bound (see paper)
33% identity, 24% coverage: 601:792/804 of query aligns to 13:205/576 of 3ivaA
Sites not aligning to the query:
3bulA E. Coli i690c/g743c meth c-terminal fragment (649-1227) (see paper)
33% identity, 24% coverage: 601:792/804 of query aligns to 13:205/577 of 3bulA
Sites not aligning to the query:
3ezxA Structure of methanosarcina barkeri monomethylamine corrinoid protein
36% identity, 24% coverage: 593:783/804 of query aligns to 1:193/212 of 3ezxA
Sites not aligning to the query:
1bmtA How a protein binds b12: a 3.O angstrom x-ray structure of the b12- binding domains of methionine synthase (see paper)
33% identity, 24% coverage: 601:792/804 of query aligns to 13:205/246 of 1bmtA
Sites not aligning to the query:
>207036 MicrobesOnline__882:207036
MPDFRQALRAGRRLLFDGGLGTMLQARGLPAGVSPEQFCLDRPDVLRGIHADYVRAGADI
LTTNTFGGSRFKLGDGFDVVDFNRRMAAIAREAADASGRQAFVAGSIGPTGHFVKPLGEV
EPAALVAAFREQVRGLVAGGADLLMIETQFDLAEARAAVVAARAECSLPIAVSMTFENGV
SLTGSTPEVFVATMLNLGVDLLGTNCSAGPDQMHDVVASLLASASVPVLVEPNAGLPELI
DGKTVFRLPPAPFAEKTAAFAAMGARVLGGCCGTTPDHIAALRQAVADIPATLPVDSGVG
IVLTTRSHLVRVGGDAPVRIIGERINPTGKKQLIAELQAGDFSLALRFSDEQVEAGAPIL
DVNVGAPMVDEEVLLPDLVQRLITRHGVPLSIDSSNAAAIERALPYCPGSTLVNSISGEP
GRMERLGPLCRDHGAPFILLPLKGRKLPVAATERIAIIEELLVQAEGLGIPRRLVMVDVL
ALAVSSKAEAARQCLETIRWCTANGFATTIGLSNISFGLPARELLNGTFLAMAAGAGLSS
CIAHPGNGRIRETVACADVLLARDANAERFIDAYAAWTPATQGGPVASGPGLASQPPATT
LEEAVVKGDRDGVTAIVESELAAGADPFDLVQTKLIPAINEVGVKYERREYFLPQLIRSA
ETMQTAFRRLQPLLEEMRGAEVRPVIIMATVEGDIHDIGKNIVSLMLGNHGFEVVDLGKD
VKAETIVDAAETHGARIIGLSALMTTTMVRMEDTVKLVRARGLDVKVIVGGAVVTKAFAD
AIGADGYSADAVEAVRLAKSLLAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory