Comparing 207105 DVU1647 diaminopimelate decarboxylase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
51% identity, 98% coverage: 4:407/412 of query aligns to 3:409/418 of 4xg1B
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
46% identity, 95% coverage: 20:411/412 of query aligns to 6:398/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
46% identity, 95% coverage: 20:411/412 of query aligns to 4:390/394 of 3c5qA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
46% identity, 98% coverage: 4:407/412 of query aligns to 3:384/393 of 4xg1A
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
41% identity, 98% coverage: 5:409/412 of query aligns to 12:429/438 of Q58497
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
41% identity, 98% coverage: 5:409/412 of query aligns to 8:425/434 of 1twiA
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
41% identity, 98% coverage: 5:409/412 of query aligns to 8:425/434 of 1tufA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
42% identity, 94% coverage: 21:407/412 of query aligns to 7:380/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
42% identity, 94% coverage: 21:407/412 of query aligns to 6:379/385 of 2yxxA
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
37% identity, 100% coverage: 2:412/412 of query aligns to 3:421/422 of 6n2aA
1knwA Crystal structure of diaminopimelate decarboxylase
35% identity, 96% coverage: 10:403/412 of query aligns to 3:409/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
35% identity, 96% coverage: 10:403/412 of query aligns to 4:410/420 of P00861
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
35% identity, 96% coverage: 10:403/412 of query aligns to 3:409/419 of 1ko0A
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 98% coverage: 7:411/412 of query aligns to 21:442/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 98% coverage: 7:411/412 of query aligns to 21:442/443 of 5x7mA
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
32% identity, 96% coverage: 16:411/412 of query aligns to 28:444/446 of 1hkvA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
32% identity, 96% coverage: 16:411/412 of query aligns to 29:445/447 of P9WIU7
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
33% identity, 97% coverage: 14:411/412 of query aligns to 4:410/412 of 7ru7A
8d4iA Structure of y430f d-ornithine/d-lysine decarboxylase complex with putrescine (see paper)
28% identity, 99% coverage: 4:411/412 of query aligns to 23:457/462 of 8d4iA
8d88A Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- lysine (see paper)
28% identity, 99% coverage: 4:411/412 of query aligns to 23:457/461 of 8d88A
>207105 DVU1647 diaminopimelate decarboxylase
MHLFQYREGSLFAEDVSIIDLASTYGTPLYVYSAGTLERHYRAFDSAFGKAAHLTCFSVK
ACSNIHILKLLGSLGAGVDIVSGGELHRALLAGIPGRRIVYSGVGKRPDEIRSALEADIL
MFNVESLQELRTIEEVAASMGTTARVSLRINPDVDPHTHPYISTGLQKNKFGIEMTQALE
GYMLARDLPHIDPIGIDCHIGSQLTSLSPFLEALDKVLEFREHLSILGLDISYLDLGGGL
GITYGEETPPHPRDFGRAVLERTKGLNLTLVLEPGRVIAGNAGILVTEVLYTKTTPSKQF
VIVDAAMNDLVRPSLYASYHRIAEVLPHGRTEQTVDVVGPICESGDFLARDRVLPAVEQG
ELLAVFSAGAYGFSMSSQYNSRPRAAEVLVRGDTAKSIRRRETYDDLTALEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory