SitesBLAST
Comparing 207124 MicrobesOnline__882:207124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/167 of Q48255
- N76 (= N79) binding
- H82 (= H85) binding
- D89 (= D92) binding
- R113 (= R117) binding
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/158 of 4b6sA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N13), L14 (= L17), Y22 (= Y25), N76 (= N79), G78 (= G81), A79 (= A82), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/158 of 2xb9A
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N13), Y22 (= Y25), N76 (= N79), A79 (= A82), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/158 of 1j2yA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y22 (= Y25), N76 (= N79), G78 (= G81), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/157 of 4b6rA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: Y22 (= Y25), N76 (= N79), G78 (= G81), A79 (= A82), H82 (= H85), D89 (= D92), L93 (≠ W96), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
2xd9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/153 of 2xd9A
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (4r,6r,7s)-4,6,7-trihydroxy-2-[(1e)-prop-1-en-1-yl]-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N13), L14 (= L17), Y22 (= Y25), N76 (= N79), G78 (= G81), A79 (= A82), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
2wksA Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor. (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 2:142/153 of 2wksA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: L11 (= L14), Y22 (= Y25), N76 (= N79), G78 (= G81), A79 (= A82), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
2xdaA Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
41% identity, 92% coverage: 5:147/155 of query aligns to 2:143/150 of 2xdaA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N76 (= N79), A79 (= A82), E100 (= E103), H102 (= H105), R109 (= R112)
- binding (4r,6r,7s)-2-(2-cyclopropylethyl)-4,6,7-trihydroxy-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N13), L11 (= L14), M13 (≠ A16), Y22 (= Y25), N76 (= N79), A79 (= A82), H82 (= H85), H102 (= H105), L103 (= L106), T104 (≠ S107), R113 (= R117)
2c4wA Type ii dehydroquinase from h. Pylori in complex with ah9095 (see paper)
42% identity, 92% coverage: 5:146/155 of query aligns to 11:151/168 of 2c4wA
- active site: P18 (= P12), N19 (= N13), R26 (= R20), Y31 (= Y25), N85 (= N79), A88 (= A82), E109 (= E103), H111 (= H105), R118 (= R112)
- binding n-tetrazol-5-yl 9-oxo-9h-xanthene-2 sulphonamide: L20 (= L14), L23 (= L17), D27 (≠ Q21), G87 (= G81), H91 (= H85), H111 (= H105), L112 (= L106), T113 (≠ S107), I115 (≠ V109), R122 (= R117)
5ydbA Crystal structure of the complex of type ii dehydroquinate dehydratase from acinetobacter baumannii with dehydroquinic acid at 1.76 angstrom resolution
45% identity, 92% coverage: 6:147/155 of query aligns to 3:141/145 of 5ydbA
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N74 (= N79), A77 (= A82), E98 (= E103), H100 (= H105), R107 (= R112)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: N74 (= N79), A76 (≠ G81), A77 (= A82), H80 (= H85), H100 (= H105), L101 (= L106), S102 (= S107), R111 (= R117)
5b6pB Structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution (see paper)
45% identity, 92% coverage: 6:147/155 of query aligns to 3:141/145 of 5b6pB
- active site: P9 (= P12), N10 (= N13), R17 (= R20), Y22 (= Y25), N74 (= N79), A77 (= A82), E98 (= E103), H100 (= H105), R107 (= R112)
- binding sulfate ion: N74 (= N79), H100 (= H105), L101 (= L106), S102 (= S107)
2c57A H.Pylori type ii dehydroquinase in complex with fa1 (see paper)
39% identity, 92% coverage: 5:146/155 of query aligns to 15:148/164 of 2c57A
- active site: P22 (= P12), N23 (= N13), N82 (= N79), A85 (= A82), E106 (= E103), H108 (= H105), R115 (= R112)
- binding 2,3 -anhydro-quinic acid: N82 (= N79), G84 (= G81), A85 (= A82), H88 (= H85), H108 (= H105), L109 (= L106), T110 (≠ S107), R119 (= R117)
2cjfA Type ii dehydroquinase inhibitor complex (see paper)
44% identity, 89% coverage: 6:143/155 of query aligns to 8:142/149 of 2cjfA
- binding (1s,4s,5s)-1,4,5-trihydroxy-3-[3-(phenylthio)phenyl]cyclohex-2-ene-1-carboxylic acid: N15 (= N13), L16 (= L14), L18 (≠ A16), L19 (= L17), R22 (= R20), Y27 (= Y25), N78 (= N79), A80 (≠ G81), A81 (= A82), H84 (= H85), H105 (= H105), I106 (≠ L106), S107 (= S107), R116 (= R117)
2bt4A Type ii dehydroquinase inhibitor complex (see paper)
44% identity, 89% coverage: 6:143/155 of query aligns to 8:142/149 of 2bt4A
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N15 (= N13), L18 (≠ A16), R22 (= R20), Y27 (= Y25), N78 (= N79), A80 (≠ G81), A81 (= A82), H84 (= H85), H105 (= H105), I106 (≠ L106), S107 (= S107), R116 (= R117)
1gu1A Crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with 2,3-anhydro-quinic acid (see paper)
44% identity, 89% coverage: 6:143/155 of query aligns to 8:142/149 of 1gu1A
- active site: P14 (= P12), N15 (= N13), R22 (= R20), Y27 (= Y25), N78 (= N79), A81 (= A82), E103 (= E103), H105 (= H105), R112 (= R112)
- binding 2,3 -anhydro-quinic acid: Y27 (= Y25), N78 (= N79), A80 (≠ G81), A81 (= A82), H84 (= H85), H105 (= H105), I106 (≠ L106), S107 (= S107), R116 (= R117)
- binding glycerol: N15 (= N13), L16 (= L14), L19 (= L17), Y27 (= Y25)
1v1jA Crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro (see paper)
44% identity, 89% coverage: 6:143/155 of query aligns to 9:143/150 of 1v1jA
- active site: P15 (= P12), N16 (= N13), R23 (= R20), Y28 (= Y25), N79 (= N79), A82 (= A82), E104 (= E103), H106 (= H105), R113 (= R112)
- binding 2-anhydro-3-fluoro-quinic acid: Y28 (= Y25), N79 (= N79), A81 (≠ G81), A82 (= A82), H85 (= H85), H106 (= H105), I107 (≠ L106), S108 (= S107), R117 (= R117)
P15474 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
44% identity, 89% coverage: 6:143/155 of query aligns to 10:144/157 of P15474
- R24 (= R20) mutation to A: Reduces kcat 30000-fold. Reduces KM for 3-dehydroquinate 6-fold.; mutation to K: Reduces kcat 2700-fold. Reduces KM for 3-dehydroquinate 4-fold.; mutation to Q: Reduces kcat 3100-fold. Reduces KM for 3-dehydroquinate 8-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
44% identity, 92% coverage: 5:147/155 of query aligns to 3:141/147 of 8idrC
1gtzA Structure of streptomyces coelicolor type ii dehydroquinase r23a mutant in complex with dehydroshikimate (see paper)
43% identity, 89% coverage: 6:143/155 of query aligns to 8:142/149 of 1gtzA
- active site: P14 (= P12), N15 (= N13), A22 (≠ R20), Y27 (= Y25), N78 (= N79), A81 (= A82), E103 (= E103), H105 (= H105), R112 (= R112)
- binding 3-dehydroshikimate: Y27 (= Y25), A80 (≠ G81), A81 (= A82), H84 (= H85), H105 (= H105), I106 (≠ L106), S107 (= S107), R116 (= R117)
6hsaA The crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876
39% identity, 91% coverage: 5:145/155 of query aligns to 5:143/145 of 6hsaA
Query Sequence
>207124 MicrobesOnline__882:207124
MPSYRLLIMNGPNLGALGERQPEIYGTTGMDTVPALVKSLLGPAASDIELTFFQSNHEGA
LIDRLEQARRDGVDGVILNAGAFTHTSLALADCLAWIGIPCVEVHLSNVMARQEPMRHKS
LIGRHVIGIIAGFGIMGYALAVQAMVQHSRKSGDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory