Comparing 207139 MicrobesOnline__882:207139 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2p3nA Thermotoga maritima impase tm1415 (see paper)
39% identity, 90% coverage: 13:250/263 of query aligns to 8:239/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
39% identity, 90% coverage: 13:250/263 of query aligns to 8:239/256 of O33832
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
39% identity, 86% coverage: 9:233/263 of query aligns to 5:236/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 86% coverage: 9:233/263 of query aligns to 1:232/267 of P0ADG4
Sites not aligning to the query:
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
36% identity, 95% coverage: 1:249/263 of query aligns to 1:257/277 of P29218
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
39% identity, 86% coverage: 9:233/263 of query aligns to 1:232/262 of 2qflA
6zk0AAA human impase with ebselen (see paper)
36% identity, 94% coverage: 4:249/263 of query aligns to 1:254/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
36% identity, 94% coverage: 4:249/263 of query aligns to 2:255/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
36% identity, 94% coverage: 4:249/263 of query aligns to 2:255/275 of 6giuA
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
44% identity, 81% coverage: 22:233/263 of query aligns to 18:229/258 of 3lv0A
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
36% identity, 92% coverage: 7:249/263 of query aligns to 3:253/266 of 1imdA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
36% identity, 92% coverage: 7:249/263 of query aligns to 3:253/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
36% identity, 92% coverage: 7:249/263 of query aligns to 3:253/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
36% identity, 92% coverage: 7:249/263 of query aligns to 3:253/272 of 1awbA
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 79% coverage: 20:228/263 of query aligns to 22:236/271 of Q9M8S8
6tqoT Rrn anti-termination complex (see paper)
38% identity, 86% coverage: 9:233/263 of query aligns to 1:224/255 of 6tqoT
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
45% identity, 74% coverage: 40:233/263 of query aligns to 25:211/238 of 3luzA
Sites not aligning to the query:
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
35% identity, 90% coverage: 1:236/263 of query aligns to 1:243/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
35% identity, 89% coverage: 4:236/263 of query aligns to 2:241/274 of 2bjiA
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
33% identity, 93% coverage: 4:248/263 of query aligns to 2:254/274 of 4as5A
>207139 MicrobesOnline__882:207139
MSIPETELLHRVLDVVRESGDLVREHWKRPRNVRLKGRIDLVTDTDMAVEAFLKARLEQV
LPGSTFVAEESASSLTPGEDCWIIDPIDGTTNFAHGVPFVATSIGLWRNGGVALGVVDIP
VMGETFWATRGGGAWCNGEPVHVSRRMPLAESLVATGFPYTISEKVDEVVDRLRRVLVEA
RGVRRCGAAAVDLAYVAAGRYEAFYEDDLKPWDTAAGWLLVEEAGGAVTSFDGTAYGFGR
ALLATNGLVHQDMVSLLVTEGKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory