SitesBLAST
Comparing 207152 MicrobesOnline__882:207152 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
39% identity, 100% coverage: 2:324/324 of query aligns to 3:310/485 of Q8DLI5
- R6 (= R5) binding
- Y192 (= Y193) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
39% identity, 100% coverage: 2:324/324 of query aligns to 2:309/484 of 2cfoA
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
38% identity, 86% coverage: 1:279/324 of query aligns to 102:362/564 of 3al0C
- active site: S110 (= S9), K335 (= K252)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R5), A108 (= A7), P109 (= P8), G118 (= G17), T122 (≠ A21), E142 (= E41), Y276 (= Y193), R294 (= R211), G295 (= G212), D297 (= D214), H298 (≠ L215), L324 (= L241), I325 (≠ L242), L333 (= L250)
- binding : T144 (≠ I43), D145 (= D44), R148 (= R47), Y208 (= Y106), P213 (vs. gap), K252 (≠ F168), M255 (≠ Q171), I266 (≠ A183), K269 (≠ R186), S270 (= S187), Y276 (= Y193), D297 (= D214), H298 (≠ L215), L299 (= L216), S300 (= S217), N301 (≠ C218), K304 (≠ R221), R330 (≠ G247), P332 (≠ R249)
Sites not aligning to the query:
- binding : 363, 364, 365, 370, 387, 389, 391, 392, 397, 400, 407, 446, 447, 453, 457, 509, 520, 524, 527, 535, 536, 538, 539
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
35% identity, 85% coverage: 3:279/324 of query aligns to 3:280/485 of 4griB
- active site: S9 (= S9), K253 (= K252)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (= E41), Y194 (= Y193), R212 (= R211), W216 (≠ L215)
- binding zinc ion: C105 (= C105), C107 (= C107), Y128 (= Y128), C132 (= C132)
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
36% identity, 86% coverage: 2:279/324 of query aligns to 3:267/468 of 8i9iA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
36% identity, 86% coverage: 2:279/324 of query aligns to 3:267/471 of P04805
- C98 (= C105) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C107) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (= C132) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ N134) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ R142) mutation to Q: No change in activity or in zinc content.
- H131 (≠ E144) mutation to Q: No change in activity or in zinc content.
- H132 (≠ K145) mutation to Q: No change in activity or in zinc content.
- C138 (vs. gap) mutation to S: No change in activity or in zinc content.
- S239 (≠ A251) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
35% identity, 88% coverage: 2:286/324 of query aligns to 4:296/488 of 8vc5A
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
36% identity, 86% coverage: 2:279/324 of query aligns to 3:252/380 of 4g6zA
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 2cv2A
- active site: K246 (= K252)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R5), A7 (= A7), S9 (= S9), G17 (= G17), I21 (≠ A21), E41 (= E41), Y187 (= Y193), R205 (= R211), A206 (≠ G212), E208 (≠ D214), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding : S9 (= S9), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ A151), R163 (≠ F168), Y168 (≠ A173), E172 (≠ S177), V177 (≠ A183), K180 (≠ R186), S181 (= S187), Y187 (= Y193), E207 (≠ A213), E208 (≠ D214), W209 (≠ L215), V211 (≠ S217), R237 (≠ L243), K241 (≠ G247), L272 (≠ M278), M273 (≠ L279), G274 (≠ A280)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 432, 435, 442, 443, 444, 446, 447, 448
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 2cv1A
- active site: K246 (= K252)
- binding adenosine-5'-triphosphate: P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ N18), I21 (≠ A21), R47 (= R47), A206 (≠ G212), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R5), A7 (= A7), E41 (= E41), Y187 (= Y193), R205 (= R211), W209 (≠ L215)
- binding : S9 (= S9), E41 (= E41), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ A151), R163 (≠ F168), V166 (≠ Q171), E172 (≠ S177), V177 (≠ A183), K180 (≠ R186), S181 (= S187), Y187 (= Y193), E207 (≠ A213), E208 (≠ D214), W209 (≠ L215), V211 (≠ S217), R237 (≠ L243), K241 (≠ G247), K243 (≠ R249), M273 (≠ L279), G274 (≠ A280), S276 (≠ M282)
Sites not aligning to the query:
- binding : 282, 299, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 1n78A
- active site: K246 (= K252)
- binding glutamol-amp: R5 (= R5), A7 (= A7), P8 (= P8), S9 (= S9), G17 (= G17), T18 (≠ N18), I21 (≠ A21), E41 (= E41), Y187 (= Y193), N191 (≠ V197), R205 (= R211), A206 (≠ G212), E208 (≠ D214), W209 (≠ L215), L235 (= L241), L236 (= L242)
- binding : S9 (= S9), T43 (≠ I43), D44 (= D44), R47 (= R47), V145 (≠ A151), R163 (≠ F168), V166 (≠ Q171), Y168 (≠ A173), E172 (≠ S177), V177 (≠ A183), K180 (≠ R186), S181 (= S187), Y187 (= Y193), E207 (≠ A213), E208 (≠ D214), W209 (≠ L215), L210 (= L216), V211 (≠ S217), R237 (≠ L243), K241 (≠ G247), M273 (≠ L279), G274 (≠ A280)
Sites not aligning to the query:
- binding : 282, 297, 303, 304, 309, 312, 319, 357, 358, 417, 427, 432, 435, 442, 443, 444, 446, 447, 448
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 1j09A
- active site: K246 (= K252)
- binding adenosine-5'-triphosphate: H15 (= H15), E208 (≠ D214), L235 (= L241), L236 (= L242), K243 (≠ R249), I244 (≠ L250), S245 (≠ A251), K246 (= K252), R247 (= R253)
- binding glutamic acid: R5 (= R5), A7 (= A7), S9 (= S9), E41 (= E41), Y187 (= Y193), N191 (≠ V197), R205 (= R211), W209 (≠ L215)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of P27000
Sites not aligning to the query:
- 358 R→Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
34% identity, 88% coverage: 1:285/324 of query aligns to 1:279/468 of 1g59A
- binding : D44 (= D44), R45 (≠ P45), A46 (≠ D46), R47 (= R47), P109 (≠ R109), V145 (≠ A151), R163 (≠ F168), V166 (≠ Q171), E172 (≠ S177), V177 (≠ A183), K180 (≠ R186), S181 (= S187), D182 (= D188), E207 (≠ A213), E208 (≠ D214), R237 (≠ L243), K241 (≠ G247), T242 (≠ E248), K243 (≠ R249), M273 (≠ L279), G274 (≠ A280)
Sites not aligning to the query:
- binding : 282, 299, 300, 303, 304, 309, 312, 319, 357, 358, 417, 426, 427, 432, 435, 442, 443, 444, 445, 446, 447, 448
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
39% identity, 78% coverage: 4:256/324 of query aligns to 18:245/308 of P27305
- E55 (= E41) binding
- Y182 (= Y193) binding
- R200 (= R211) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
40% identity, 77% coverage: 4:253/324 of query aligns to 6:230/290 of 4a91A
- active site: S11 (= S9), K229 (= K252)
- binding glutamic acid: R7 (= R5), A9 (= A7), S11 (= S9), E43 (= E41), Y170 (= Y193), R188 (= R211), L192 (= L215)
- binding zinc ion: C99 (= C105), C101 (= C107), Y113 (= Y128), C117 (= C132)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
33% identity, 78% coverage: 2:253/324 of query aligns to 3:262/502 of 6brlA
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
30% identity, 72% coverage: 5:238/324 of query aligns to 14:228/455 of 3aiiA
Sites not aligning to the query:
4h3sA The structure of glutaminyl-tRNA synthetase from saccharomyces cerevisiae (see paper)
30% identity, 43% coverage: 2:139/324 of query aligns to 38:164/585 of 4h3sA
Sites not aligning to the query:
Query Sequence
>207152 MicrobesOnline__882:207152
MIRGRLAPSPTGNIHLGNAWAFMLAWLAARQAGGKVLLRMEDIDPDRARPEYAEGIMADL
RWLGLDWDEGPDIGGPCGPYVQSRRVQDYARVLDVLATLGAVYPCYCTRKELRTLAGAPH
PGDLGAPYPGTCRNLTIEECSRKEKEGRRPAMRLRWPDGVFAFDDGLFGPQQAGGESCGG
DFALRRSDGVFAYQLAVVVDDIAMGVTQVVRGADLLSCTPRQLALYSLLGAQPPAYLHVP
LLLDATGERLAKRHQSLEIRALRNAGVPAANITGYLAMLAGMIPDFVPRAPKDCVGLLST
ATLPTRPLVTPADILDRLKKGTSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory