Comparing 207248 MicrobesOnline__882:207248 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5odqB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with bromoethanesulfonate. (see paper)
24% identity, 81% coverage: 8:210/250 of query aligns to 1:224/291 of 5odqB
Sites not aligning to the query:
5odhH Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
24% identity, 81% coverage: 8:210/250 of query aligns to 1:224/291 of 5odhH
Sites not aligning to the query:
5odhB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 3.5 minutes (see paper)
24% identity, 81% coverage: 8:210/250 of query aligns to 1:224/291 of 5odhB
Sites not aligning to the query:
5odcB Heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus at 2.3 a resolution (see paper)
24% identity, 81% coverage: 8:210/250 of query aligns to 1:224/291 of 5odcB
Sites not aligning to the query:
>207248 MicrobesOnline__882:207248
MYTYPEDIKTVYFFGTCLVDMSFPDAGMAGIRLLQRAGVEVVFPAAQSCCGQPAYNSGFF
DEARTVALRQVEAFSAHDWPIVVPSGSCAGMMRFHYPELFAEAPDYFEVRRFSERVFELG
DFLCNALHQTYEDKGAPIKVTWHSSCHAMREMGAVAAAKTLIGQLANVELVDLPYEYECC
GFGGTFSIKQPELSGAMVSDKVANIRSTGAARVLSGDCGCLMNINGAMEKQSVPVQGQHL
ASFLWERING
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory