SitesBLAST
Comparing 207401 MicrobesOnline__882:207401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zm7I Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
36% identity, 44% coverage: 83:147/147 of query aligns to 77:148/185 of 7zm7I
- binding iron/sulfur cluster: C86 (= C92), I87 (≠ M93), A88 (≠ H94), C89 (= C95), K90 (≠ G96), C92 (= C98), C96 (= C102), P97 (= P103), I101 (≠ L107), Y118 (≠ F118), C125 (= C123), I126 (≠ T124), Y127 (≠ A125), C128 (= C126), C131 (= C129), C135 (= C133), A139 (= A137), I140 (≠ M138)
Sites not aligning to the query:
5t61L Tungsten formylmethanofuran dehydrogenase subunit fwdF (see paper)
31% identity, 39% coverage: 81:138/147 of query aligns to 142:208/348 of 5t61L
- binding iron/sulfur cluster: I146 (= I85), C153 (= C92), C156 (= C95), C159 (= C98), C163 (= C102), P164 (= P103), I168 (≠ L107), I186 (≠ V116), C193 (= C123), H195 (≠ A125), C196 (= C126), G197 (= G127), C199 (= C129), C203 (= C133), P204 (= P134), I208 (≠ M138)
Sites not aligning to the query:
- binding iron/sulfur cluster: 30, 31, 32, 33, 34, 36, 40, 41, 70, 71, 72, 73, 74, 76, 80, 85, 114, 117, 118, 120, 124, 129, 212, 215, 238, 239, 240, 241, 242, 244, 248, 249, 270, 272, 273, 274, 276, 280, 281, 284, 307, 308, 309, 310, 311, 313, 317
7b0nI 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
37% identity, 44% coverage: 83:147/147 of query aligns to 83:154/191 of 7b0nI
- binding iron/sulfur cluster: C92 (= C92), I93 (≠ M93), A94 (≠ H94), C95 (= C95), K96 (≠ G96), C98 (= C98), C102 (= C102), C131 (= C123), I132 (≠ T124), Y133 (≠ A125), C134 (= C126), G135 (= G127), C137 (= C129), C141 (= C133), E148 (= E141)
Sites not aligning to the query:
7arcI Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
36% identity, 38% coverage: 83:138/147 of query aligns to 91:154/199 of 7arcI
- binding iron/sulfur cluster: C100 (= C92), I101 (≠ M93), S102 (≠ H94), C103 (= C95), K104 (≠ G96), C106 (= C98), C110 (= C102), P111 (= P103), I115 (≠ L107), Y132 (≠ F118), C139 (= C123), I140 (≠ T124), Y141 (≠ A125), C142 (= C126), G143 (= G127), F144 (≠ L128), C145 (= C129), C149 (= C133), A153 (= A137), I154 (≠ M138)
- binding : R131 (≠ T117)
Sites not aligning to the query:
7ak5I Cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a (see paper)
36% identity, 38% coverage: 83:138/147 of query aligns to 70:133/178 of 7ak5I
- binding iron/sulfur cluster: C79 (= C92), I80 (≠ M93), A81 (≠ H94), C82 (= C95), K83 (≠ G96), C85 (= C98), C89 (= C102), C118 (= C123), I119 (≠ T124), Y120 (≠ A125), C121 (= C126), G122 (= G127), C124 (= C129), C128 (= C133), I133 (≠ M138)
Sites not aligning to the query:
8b9zI Drosophila melanogaster complex i in the active state (dm1) (see paper)
36% identity, 38% coverage: 83:138/147 of query aligns to 78:141/186 of 8b9zI
- binding iron/sulfur cluster: C87 (= C92), I88 (≠ M93), A89 (≠ H94), C90 (= C95), K91 (≠ G96), C93 (= C98), C97 (= C102), P98 (= P103), Y119 (≠ F118), C126 (= C123), I127 (≠ T124), Y128 (≠ A125), C129 (= C126), G130 (= G127), F131 (≠ L128), C132 (= C129), C136 (= C133), A140 (= A137), I141 (≠ M138)
Sites not aligning to the query:
Q9VF27 NADH dehydrogenase (ubiquinone) 23 kDa subunit; EC 7.1.1.2 from Drosophila melanogaster (Fruit fly) (see paper)
36% identity, 38% coverage: 83:138/147 of query aligns to 109:172/217 of Q9VF27
Sites not aligning to the query:
- 199 G→D: Disrupts mitochondrial function and results in enlarged mitochondria. Neurons present vacuolar lesions leading to neurodegeneration in the central brain. Results in behavioral defects and shorten lifespan.
8e73S8 qcr9 (see paper)
36% identity, 38% coverage: 83:138/147 of query aligns to 73:136/181 of 8e73S8
- binding iron/sulfur cluster: C82 (= C92), I83 (≠ M93), C85 (= C95), K86 (≠ G96), C88 (= C98), C92 (= C102), I97 (≠ L107), C121 (= C123), I122 (≠ T124), Y123 (≠ A125), C124 (= C126), G125 (= G127), F126 (≠ L128), C127 (= C129), C131 (= C133), P132 (= P134), A135 (= A137), I136 (≠ M138)
Sites not aligning to the query:
5gupH structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 68:131/176 of 5gupH
- binding iron/sulfur cluster: C77 (= C92), I78 (≠ M93), A79 (≠ H94), C80 (= C95), K81 (≠ G96), C83 (= C98), C87 (= C102), C116 (= C123), I117 (≠ T124), Y118 (≠ A125), C119 (= C126), G120 (= G127), F121 (≠ L128), C122 (= C129), C126 (= C133), P127 (= P134), A130 (= A137), I131 (≠ M138)
- binding : R108 (≠ T117)
Sites not aligning to the query:
8b6fAL ndutt15 (see paper)
34% identity, 38% coverage: 83:138/147 of query aligns to 109:172/218 of 8b6fAL
- binding iron/sulfur cluster: C118 (= C92), I119 (≠ M93), C121 (= C95), K122 (≠ G96), C124 (= C98), C128 (= C102), I133 (≠ L107), Y150 (≠ F118), C157 (= C123), I158 (≠ T124), Y159 (≠ A125), C160 (= C126), G161 (= G127), C163 (= C129), C167 (= C133), P168 (= P134), A171 (= A137), I172 (≠ M138)
Sites not aligning to the query:
6cfwN Cryoem structure of a respiratory membrane-bound hydrogenase (see paper)
33% identity, 41% coverage: 84:143/147 of query aligns to 37:96/121 of 6cfwN
- binding iron/sulfur cluster: C45 (= C92), G47 (≠ H94), C48 (= C95), M50 (= M97), C51 (= C98), C55 (= C102), C76 (= C123), M78 (≠ A125), C79 (= C126), C82 (= C129), C86 (= C133)
6h8kI NUAM protein (see paper)
40% identity, 39% coverage: 90:147/147 of query aligns to 40:101/137 of 6h8kI
- binding iron/sulfur cluster: C42 (= C92), C45 (= C95), C48 (= C98), C52 (= C102), A56 (= A106), C78 (= C123), I79 (≠ T124), Y80 (≠ A125), C81 (= C126), G82 (= G127), Y83 (≠ L128), C84 (= C129), C88 (= C133), A92 (= A137)
7bkdA Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (heterodislfide reductase core and mobile arm in conformational state 1, composite structure) (see paper)
40% identity, 36% coverage: 89:141/147 of query aligns to 593:647/664 of 7bkdA
- binding iron/sulfur cluster: C596 (= C92), A597 (≠ M93), C599 (= C95), G600 (= G96), C602 (= C98), C606 (= C102), L611 (= L107), C629 (= C123), K630 (≠ T124), C632 (= C126), G633 (= G127), C635 (= C129), C639 (= C133), I644 (≠ M138)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 149, 150, 152, 153, 173, 174, 180, 181, 185, 188, 189, 339, 340, 341, 342, 368, 419, 422, 552, 557, 559
- binding iron/sulfur cluster: 10, 12, 45, 69, 70, 257, 259, 260, 261, 263, 267, 268, 284, 285, 297, 304, 305, 306, 307, 308, 310, 314, 319, 397, 398, 412, 413, 414, 416, 417, 444
8a8oD Paps reductase from methanothermococcus thermolithotrophicus refined to 1.45 a (see paper)
33% identity, 37% coverage: 89:143/147 of query aligns to 6:60/102 of 8a8oD
- binding iron/sulfur cluster: C9 (= C92), I10 (≠ M93), G11 (≠ H94), C12 (= C95), G13 (= G96), C15 (= C98), C19 (= C102), P20 (= P103), S32 (≠ T115), C40 (= C123), W41 (≠ T124), D42 (≠ A125), C43 (= C126), A44 (≠ G127), C46 (= C129), C50 (= C133), I55 (≠ M138)
Sites not aligning to the query:
7m31A Dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with thymine and NADPH anaerobically (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 943:992/1011 of 7m31A
- binding iron/sulfur cluster: C947 (= C92), I948 (≠ M93), N949 (≠ H94), C950 (= C95), G951 (= G96), C953 (= C98), C957 (= C102), I965 (≠ L107), P974 (≠ V116), C980 (= C123), T981 (= T124), G982 (≠ A125), C983 (= C126), T984 (≠ G127), C986 (= C129), C990 (= C133), P991 (= P134)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 228, 229, 233, 259, 281, 341, 478, 479, 486, 487, 490
- binding flavin mononucleotide: 548, 549, 572, 573, 588, 607, 666, 703, 760, 761, 787, 788, 789, 810, 811, 814
- binding nadp nicotinamide-adenine-dinucleotide phosphate: 338, 339, 340, 341, 362, 363, 435, 436, 437, 485
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 93, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154, 940, 995, 996
- binding thymine: 607, 610, 730, 731
1h7xA Dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex of a mutant enzyme (c671a), NADPH and 5-fluorouracil (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 948:997/1016 of 1h7xA
- binding iron/sulfur cluster: C952 (= C92), I953 (≠ M93), N954 (≠ H94), C955 (= C95), G956 (= G96), C958 (= C98), C962 (= C102), I970 (≠ L107), C985 (= C123), T986 (= T124), G987 (≠ A125), C988 (= C126), T989 (≠ G127), C991 (= C129), C995 (= C133), P996 (= P134)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 673, 708, 734
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 234, 259, 260, 282, 283, 285, 342, 480, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 708, 765, 766, 792, 793, 794, 815, 816, 819
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 338, 339, 342, 363, 364, 370, 436, 437, 480, 483, 484, 485, 486
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 134, 135, 139, 140, 141, 149, 151, 155, 945, 1001
- binding 5-fluorouracil: 608, 610, 735, 736
8f61B Dihydropyrimidine dehydrogenase (dpd) c671s mutant soaked with dihydrothymine quasi-anaerobically (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 947:996/1016 of 8f61B
- binding iron/sulfur cluster: C951 (= C92), I952 (≠ M93), N953 (≠ H94), C954 (= C95), G955 (= G96), C957 (= C98), C961 (= C102), Y966 (vs. gap), I969 (≠ L107), P978 (≠ V116), C984 (= C123), T985 (= T124), G986 (≠ A125), C987 (= C126), T988 (≠ G127), C990 (= C129), C994 (= C133), P995 (= P134)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 229, 233, 258, 259, 281, 341, 344, 478, 479, 486, 487, 490
- binding flavin mononucleotide: 548, 549, 572, 573, 607, 666, 707, 734, 764, 765, 791, 792, 793, 814, 815
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 93, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154, 488, 944, 999, 1000
- binding (5S)-5-methyl-1,3-diazinane-2,4-dione: 607, 609, 734, 735
7m32A Dihydropyrimidine dehydrogenase (dpd) c671a mutant soaked with uracil and NADPH anaerobically (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 941:990/1011 of 7m32A
- binding iron/sulfur cluster: C945 (= C92), I946 (≠ M93), N947 (≠ H94), C948 (= C95), G949 (= G96), C951 (= C98), C955 (= C102), I963 (≠ L107), P972 (≠ V116), C978 (= C123), T979 (= T124), G980 (≠ A125), C981 (= C126), T982 (≠ G127), C984 (= C129), C988 (= C133), P989 (= P134)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 127, 192, 194, 195, 196, 216, 217, 223, 224, 233, 258, 259, 281, 282, 340, 341, 478, 479, 486, 487, 490
- binding 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydro-2h-benzo[g]pteridin-1-id-10(5h)-yl)-5-o-phosphonato-d-ribitol: 548, 549, 572, 573, 588, 607, 666, 701, 758, 759, 786, 787, 808, 809, 812
- binding leucine: 577, 615
- binding iron/sulfur cluster: 77, 78, 79, 80, 84, 85, 89, 95, 128, 133, 134, 138, 139, 140, 148, 150, 154, 938, 994
- binding uracil: 607, 609, 728, 729
7ljsA Porcine dihydropyrimidine dehydrogenase (dpd) complexed with 5- ethynyluracil (5eu) - open form (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 937:986/1005 of 7ljsA
- binding iron/sulfur cluster: C941 (= C92), I942 (≠ M93), C944 (= C95), G945 (= G96), C947 (= C98), C951 (= C102), I959 (≠ L107), P968 (≠ V116), C974 (= C123), T975 (= T124), G976 (≠ A125), C977 (= C126), T978 (≠ G127), C980 (= C129), C984 (= C133), P985 (= P134)
Sites not aligning to the query:
- active site: 573, 670, 703
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 230, 234, 260, 282, 341, 342, 479, 480, 486, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 608, 667, 703, 760, 761, 787, 788, 789, 810, 811
- binding iron/sulfur cluster: 78, 80, 81, 86, 90, 94, 96, 129, 135, 139, 140, 141, 149, 155, 989
- binding 5-ethynylpyrimidine-2,4(1H,3H)-dione: 608, 611, 612, 730, 731
1gteA Dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil (see paper)
41% identity, 33% coverage: 88:135/147 of query aligns to 937:986/1005 of 1gteA
- binding iron/sulfur cluster: C941 (= C92), I942 (≠ M93), N943 (≠ H94), C944 (= C95), G945 (= G96), K946 (≠ M97), C947 (= C98), C951 (= C102), I959 (≠ L107), V970 (≠ F118), C974 (= C123), T975 (= T124), G976 (≠ A125), C977 (= C126), T978 (≠ G127), C980 (= C129), C984 (= C133), P985 (= P134)
Sites not aligning to the query:
- active site: 573, 600, 604, 670, 672, 703, 729
- binding flavin-adenine dinucleotide: 128, 193, 195, 196, 197, 217, 218, 224, 225, 234, 259, 260, 282, 283, 285, 341, 342, 479, 480, 486, 487, 488, 491
- binding flavin mononucleotide: 549, 550, 573, 574, 589, 608, 667, 703, 730, 760, 761, 787, 788, 789, 810, 811, 814
- binding 5-iodouracil: 608, 611, 612, 667, 730, 731
- binding iron/sulfur cluster: 78, 79, 80, 81, 85, 86, 90, 94, 96, 129, 131, 134, 135, 139, 140, 141, 149, 151, 155, 934, 936, 990
Query Sequence
>207401 MicrobesOnline__882:207401
MSAQPQKPYRKNVHLTFPPEISGNPLVCNLTRLFDLTFNILKAQITPRKEGYLTLELMGD
EANCTKAMEYLREHDVVVTPVAQRISRDEEGCMHCGMCTAICPTSALRMNLENRTVTFEL
DRCTACGLCTRVCPVAAMHVELENGHY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory