SitesBLAST
Comparing 207410 MicrobesOnline__882:207410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
30% identity, 48% coverage: 132:379/516 of query aligns to 120:353/496 of 3da1A
- binding flavin-adenine dinucleotide: V151 (= V168), G187 (= G204), W189 (= W206), L193 (≠ I210), G210 (= G225), T250 (= T262), G296 (= G305), R298 (= R307), G319 (= G345), K320 (= K346), L321 (= L347)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 24, 27, 28, 29, 48, 49, 55, 57, 60, 61, 63, 65
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
25% identity, 67% coverage: 26:373/516 of query aligns to 27:381/495 of 2r46A
- binding flavin-adenine dinucleotide: L32 (≠ I31), E33 (≠ D32), A34 (≠ Q33), T41 (≠ A40), S42 (= S41), A44 (≠ G43), S45 (≠ N44), S46 (≠ H45), L48 (= L47), A172 (≠ V168), T206 (≠ A203), G231 (≠ M234), R317 (= R307), G353 (= G345), K354 (= K346), L355 (= L347), T356 (= T348)
- binding phosphoenolpyruvate: R54 (= R53), Y55 (= Y54), R254 (vs. gap), T270 (= T262), D272 (≠ S264), R317 (= R307), R332 (= R324)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ A153)
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
25% identity, 67% coverage: 26:373/516 of query aligns to 27:381/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R53), Y55 (= Y54), R254 (vs. gap), I255 (vs. gap), T270 (= T262), R317 (= R307), R332 (= R324)
- binding flavin-adenine dinucleotide: E33 (≠ D32), A34 (≠ Q33), C39 (≠ A38), A40 (≠ G39), T41 (≠ A40), S42 (= S41), A44 (≠ G43), S45 (≠ N44), S46 (≠ H45), L48 (= L47), A172 (≠ V168), T206 (≠ A203), G207 (= G204), W209 (= W206), G231 (≠ M234), R317 (= R307), G353 (= G345), K354 (= K346), L355 (= L347), T356 (= T348)
- binding phosphate ion: Q212 (≠ G209), G277 (vs. gap), P279 (= P270), V310 (≠ I300)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ A153), V160 (≠ G156)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 9, 12, 13, 14
- binding phosphate ion: 398, 401, 405, 462, 464, 468
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: 455, 456, 457, 459
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
25% identity, 65% coverage: 26:359/516 of query aligns to 27:367/501 of 2qcuB
- binding flavin-adenine dinucleotide: E33 (≠ D32), A34 (≠ Q33), C39 (≠ A38), T41 (≠ A40), S42 (= S41), S45 (≠ N44), S46 (≠ H45), L48 (= L47), H50 (= H49), A172 (≠ V168), T206 (≠ A203), W209 (= W206), G231 (≠ M234), R317 (= R307), G353 (= G345), K354 (= K346), L355 (= L347), T356 (= T348)
- binding phosphate ion: R54 (= R53), Y55 (= Y54), R317 (= R307), R332 (= R324)
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 72% coverage: 5:373/516 of query aligns to 76:467/629 of Q9SS48
- S86 (≠ T15) mutation to F: In spd6-2; loss of 90% of activity.
Sites not aligning to the query:
- 546 E→G: In spd6-1; loss of 90% of activity.
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
25% identity, 39% coverage: 18:220/516 of query aligns to 20:217/374 of 1y56B
- active site: F44 (≠ G42), G47 (≠ H49), T48 (≠ S50)
- binding flavin-adenine dinucleotide: I33 (= I31), E34 (≠ D32), K35 (≠ Q33), S42 (≠ A40), T43 (≠ S41), R45 (≠ G43), C46 (≠ L48), G47 (≠ H49), G49 (= G51), E170 (≠ R167), V171 (= V168), T200 (≠ A203), N201 (≠ G204), W203 (= W206)
- binding flavin mononucleotide: F44 (≠ G42), R45 (≠ G43)
Sites not aligning to the query:
- active site: 224, 239, 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
24% identity, 66% coverage: 25:365/516 of query aligns to 41:401/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (≠ D32), M49 (≠ Q33), Q50 (≠ R34), T56 (≠ A40), S57 (= S41), A197 (≠ V168), S232 (≠ A203), G233 (= G204), W235 (= W206), G257 (≠ M234), G344 (= G305), L345 (≠ V306), Y357 (≠ R320), K382 (= K346), I383 (≠ L347), T384 (= T348)
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
23% identity, 66% coverage: 25:365/516 of query aligns to 39:393/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (≠ D32), M47 (≠ Q33), Q48 (≠ R34), T54 (≠ A40), S55 (= S41), S58 (≠ N44), T59 (≠ H45), A193 (≠ V168), S227 (≠ A203), G228 (= G204), W230 (= W206), L338 (≠ V306), R339 (= R307), Y350 (≠ S318), K374 (= K346), I375 (≠ L347), T376 (= T348)
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 64% coverage: 5:336/516 of query aligns to 4:330/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I8), G8 (= G9), G10 (= G11), V11 (≠ A12), I12 (≠ T13), V30 (≠ I31), E31 (≠ D32), K32 (≠ Q33), E38 (≠ G39), A39 (= A40), S40 (= S41), A43 (≠ N44), G45 (= G46), L46 (= L47), V171 (= V168), G200 (≠ A203), G201 (= G204), W203 (= W206), G298 (= G305), R300 (= R307), P301 (= P308), Y326 (≠ E332), R327 (≠ E333), N328 (≠ D334), G329 (= G335), I330 (≠ V336)
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
26% identity, 60% coverage: 4:315/516 of query aligns to 2:315/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G9), G9 (= G11), I10 (≠ A12), D30 (= D32), N32 (≠ R34), H33 (≠ D35), K36 (≠ A38), A37 (≠ G39), T38 (≠ A40), A40 (≠ G42), G41 (= G43), A42 (≠ N44), G43 (vs. gap), V44 (vs. gap), Y174 (≠ I178), A203 (= A203), W206 (= W206), I210 (= I210), Y250 (≠ S258), G305 (= G305), R307 (= R307)
Sites not aligning to the query:
Query Sequence
>207410 MicrobesOnline__882:207410
MQTQVLIIGAGATGTGVARDLALRGVDCILIDQRDVNAGASGGNHGLLHSGGRYVFTDPH
AAAECKAEGDILKRIAPQCIEETGGYFVAVEGDDPAYASDFPGYCAKAGVPCREVDAHEA
RRNEPAIAESTFAVYEVEDASVDPFKLSLENVADAGRHGGRYLRYTRVLGFDMERGRIVA
ARVEDMRSGREYRIVADEYVVAAGAWSGGITAMAGCHVDIVYAKGTLLVTQTRMAHRVIN
RLRTPGDGDILVPGGTVSVLGTTSLRVESPDDVRPTVAEVDVNINEGMGMVPSLADARFI
RAYAGVRPLVRSGKPSGSDRAASRGFVLLDHEEDGVHNLVTIAGGKLTTYRLMAERAADL
VCERLGVSAPCLTAVRPISPSDEAEWAEPGVLQKQNWWRNHDRDDYLLCECEIVPKSGVD
SIIATFKDEAEPPRLLAIGLRSRVGKGSCQGAFCGARITAHMHDRRIIEGREGLDGLREF
LGARWKGQRPILWGAQFNQAELKEALYFGLVGMELE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory