SitesBLAST
Comparing 207560 MicrobesOnline__882:207560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7zlaB Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the half-closed conformation (see paper)
31% identity, 96% coverage: 5:464/480 of query aligns to 2:449/458 of 7zlaB
- binding : R4 (≠ V7), P9 (≠ S12), L10 (= L13), Y11 (≠ G14), S35 (= S38), K36 (≠ S39), R37 (= R40), K38 (≠ A41), Q47 (≠ R50), Q47 (≠ R50), N48 (= N51), T49 (= T52), R68 (≠ G71)
7zn5B Cryo-em structure of holo-pdxr from bacillus clausii bound to its target DNA in the closed conformation, c2 symmetry. (see paper)
30% identity, 95% coverage: 8:464/480 of query aligns to 2:426/435 of 7zn5B
- binding : P6 (≠ S12), S32 (= S38), R34 (= R40), K35 (≠ A41), S43 (= S49), Q44 (≠ R50), N45 (= N51), E48 (≠ L54), R65 (≠ G71), K66 (≠ S72), R341 (= R377)
5t4kA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
32% identity, 77% coverage: 106:473/480 of query aligns to 1:360/360 of 5t4kA
- binding (4S)-5-fluoro-4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]pentanoic acid: H8 (≠ S113), M9 (≠ G114), T75 (≠ A180), Y99 (≠ H205), F144 (≠ Y256), D173 (= D284), Y175 (= Y286), T203 (≠ S313), S205 (= S315), R213 (= R323), R324 (≠ A435)
5t4jB Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
32% identity, 77% coverage: 106:473/480 of query aligns to 1:360/360 of 5t4jB
- binding gamma-amino-butanoic acid: H8 (≠ S113), M9 (≠ G114), Y99 (≠ H205), Y175 (= Y286), R324 (≠ A435)
- binding pyridoxal-5'-phosphate: T75 (≠ A180), Y99 (≠ H205), F144 (≠ Y256), D173 (= D284), Y175 (= Y286), T203 (≠ S313), S205 (= S315), R213 (= R323), S215 (≠ G325)
6uxzB (S)-4-amino-5-phenoxypentanoate as a selective agonist of the transcription factor gabr (see paper)
32% identity, 76% coverage: 109:472/480 of query aligns to 3:358/358 of 6uxzB
- binding (4S)-4-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-5-phenoxypentanoic acid: H7 (≠ S113), M8 (≠ G114), G73 (= G179), T74 (≠ A180), Y98 (≠ H205), R100 (≠ G207), F143 (≠ Y256), D172 (= D284), Y174 (= Y286), T202 (≠ S313), S204 (= S315), K205 (= K316), P209 (= P320), R212 (= R323), R323 (≠ A435)
5x03B Crystal structure of thE C-terminal domain of bacillus subtilis gabr reveals a closed conformation by the binding of gamma-aminobutyric acid, inducing the transcriptional activation (see paper)
32% identity, 76% coverage: 109:473/480 of query aligns to 3:364/365 of 5x03B
7pq9AAA PLP-dependent aminotransferase family protein (see paper)
30% identity, 72% coverage: 121:464/480 of query aligns to 17:353/367 of 7pq9AAA
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
27% identity, 76% coverage: 106:471/480 of query aligns to 32:398/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: G40 (= G114), L41 (≠ I115)
- binding 2-oxoglutaric acid: D213 (= D285), P214 (≠ Y286), Y215 (≠ D287), G216 (= G288), E217 (= E289), G241 (= G312), T242 (≠ S313), I246 (≠ V317)
- binding (2E)-pent-2-enedioic acid: G40 (= G114), Y130 (≠ H205), N184 (≠ Y256), R376 (≠ I449)
- binding glutamic acid: L131 (≠ A206), V360 (≠ T431), A364 (= A435), R369 (≠ H440)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (≠ H205), N184 (≠ Y256), D212 (= D284), P214 (≠ Y286), Y215 (≠ D287), T242 (≠ S313), S244 (= S315), K245 (= K316), R252 (= R323)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
27% identity, 76% coverage: 106:471/480 of query aligns to 32:398/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ A206), Q135 (≠ E210), A364 (= A435), R369 (≠ H440)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: G40 (= G114), Y130 (≠ H205), L131 (≠ A206), A132 (≠ G207), N184 (≠ Y256), R376 (≠ I449)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (≠ H205), V179 (≠ T251), N184 (≠ Y256), D212 (= D284), P214 (≠ Y286), Y215 (≠ D287), T242 (≠ S313), S244 (= S315), K245 (= K316), R252 (= R323)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
27% identity, 76% coverage: 106:471/480 of query aligns to 32:398/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y144), Y130 (≠ H205), L275 (≠ V346)
- binding pyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (≠ H205), V179 (≠ T251), N184 (≠ Y256), D212 (= D284), P214 (≠ Y286), Y215 (≠ D287), T242 (≠ S313), S244 (= S315), K245 (= K316), R252 (= R323)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
27% identity, 76% coverage: 106:471/480 of query aligns to 32:398/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G179), S105 (≠ A180), Q106 (≠ T181), Y130 (≠ H205), V179 (≠ T251), N184 (≠ Y256), D212 (= D284), P214 (≠ Y286), Y215 (≠ D287), T242 (≠ S313), S244 (= S315), K245 (= K316), R252 (= R323)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
28% identity, 76% coverage: 106:471/480 of query aligns to 29:396/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G179), S103 (≠ A180), Q104 (≠ T181), Y128 (≠ H205), V177 (≠ T251), N182 (≠ Y256), D210 (= D284), P212 (≠ Y286), Y213 (≠ D287), T240 (≠ S313), S242 (= S315), K243 (= K316), R250 (= R323)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
31% identity, 77% coverage: 103:471/480 of query aligns to 26:386/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G35 (≠ S113), G36 (= G114), G95 (= G179), S96 (≠ A180), Q97 (≠ T181), Y121 (≠ H205), N170 (≠ Y256), D198 (= D284), Y201 (≠ D287), S231 (= S313), S233 (= S315), K234 (= K316), R241 (= R323), R364 (≠ I449)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
31% identity, 77% coverage: 103:471/480 of query aligns to 26:386/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G179), S96 (≠ A180), Q97 (≠ T181), Y121 (≠ H205), N170 (≠ Y256), D198 (= D284), A200 (≠ Y286), Y201 (≠ D287), S231 (= S313), S233 (= S315), K234 (= K316), R241 (= R323)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
27% identity, 76% coverage: 108:470/480 of query aligns to 36:400/405 of 2zc0A
- active site: Y132 (≠ H205), D214 (= D284), A216 (≠ Y286), S246 (= S315)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G179), G107 (≠ A180), T108 (= T181), Y132 (≠ H205), N186 (≠ Y256), D214 (= D284), A216 (≠ Y286), Y217 (≠ D287), T244 (≠ S313), S246 (= S315), K247 (= K316), R254 (= R323)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
31% identity, 77% coverage: 103:471/480 of query aligns to 30:390/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G39 (≠ S113), G40 (= G114), G99 (= G179), S100 (≠ A180), Q101 (≠ T181), Y125 (≠ H205), N174 (≠ Y256), D202 (= D284), Y205 (≠ D287), S235 (= S313), S237 (= S315), K238 (= K316), R245 (= R323), R368 (≠ I449)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
31% identity, 77% coverage: 103:471/480 of query aligns to 30:390/397 of Q72LL6
- G40 (= G114) binding
- Y70 (= Y144) binding
- N174 (≠ Y256) binding ; binding
- R245 (= R323) binding
- R368 (≠ I449) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
30% identity, 78% coverage: 96:471/480 of query aligns to 14:382/389 of 2z1yA
- binding leucine: G32 (= G114), Y117 (≠ H205), R360 (≠ I449)
- binding pyridoxal-5'-phosphate: G91 (= G179), S92 (≠ A180), Q93 (≠ T181), Y117 (≠ H205), N166 (≠ Y256), D194 (= D284), Y197 (≠ D287), S227 (= S313), S229 (= S315), K230 (= K316), R237 (= R323)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
28% identity, 77% coverage: 109:476/480 of query aligns to 41:415/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G179), S113 (≠ A180), Q114 (≠ T181), Y138 (≠ H205), N194 (≠ Y256), D222 (= D284), P224 (≠ Y286), Y225 (≠ D287), T252 (≠ S313), S254 (= S315), K255 (= K316), R262 (= R323)
8tn3A Structure of s. Hygroscopicus aminotransferase mppq complexed with pyridoxamine 5'-phosphate (pmp) (see paper)
32% identity, 63% coverage: 105:406/480 of query aligns to 18:326/388 of 8tn3A
Query Sequence
>207560 MicrobesOnline__882:207560
MWLPLDVDGPLSLGRQLYERLKQMILDGELAAGARLPSSRALAVELGVSRNTVLDAYDQL
SAEGYLETRHGSGTRVAAGIVSERGEGGANRAPFVIAPAAVPERPSGVVSFRSGIPALDV
FPREEWARTYQRVCAALPDDALRYSAPAGVWALREAIAGYLRRTRGIRCHAERVMITSGA
TQGLRIMSRLLQRSGGVVLAEDPAHAGLREVLEVTGLRVEGVPVDDRGMDTGMLPSAEEA
RRAGVAFVYVTPSHQYPLGGILPVQRRQALVRFAREAECLIVEDDYDGEFRHEGSPVGTL
HELAPESVVYLGSFSKVLAPALRLGFAILPARLLAAWHREKLYSDVHTDALSQHALASFI
GSGALERHIWRMKKLYRRRRAFLVKSLMRHFGDAVGIRGHATGLHLVAAFTGVRFDDKVM
SELARGGVEATPVHAYALQHGDDHVNELILGYAHLSEEAMEQGVRLLKQVLGNAGRVPVG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory