Comparing 207786 MicrobesOnline__882:207786 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
49% identity, 98% coverage: 3:392/397 of query aligns to 2:382/382 of 7ahhC
7aheC Opua inhibited inward facing (see paper)
49% identity, 98% coverage: 3:392/397 of query aligns to 2:382/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
59% identity, 65% coverage: 3:260/397 of query aligns to 2:259/260 of 7ahdC
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
44% identity, 55% coverage: 50:269/397 of query aligns to 40:253/378 of P69874
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
41% identity, 66% coverage: 4:264/397 of query aligns to 3:236/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 59% coverage: 33:265/397 of query aligns to 12:244/375 of 2d62A
8hplC Lpqy-sugabc in state 1 (see paper)
40% identity, 56% coverage: 43:265/397 of query aligns to 17:233/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
40% identity, 56% coverage: 42:265/397 of query aligns to 18:235/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
40% identity, 56% coverage: 42:265/397 of query aligns to 18:235/362 of 8hprD
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 56% coverage: 46:266/397 of query aligns to 20:238/240 of 4ymuJ
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 60% coverage: 31:270/397 of query aligns to 10:235/353 of 1vciA
1g291 Malk (see paper)
37% identity, 59% coverage: 32:265/397 of query aligns to 8:241/372 of 1g291
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 66% coverage: 1:264/397 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 66% coverage: 1:264/397 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 66% coverage: 1:264/397 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 66% coverage: 1:264/397 of query aligns to 2:242/344 of 3tuiC
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
40% identity, 54% coverage: 43:257/397 of query aligns to 24:228/257 of 8wm7D
Sites not aligning to the query:
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
40% identity, 54% coverage: 43:257/397 of query aligns to 22:226/256 of 8w9mD
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
40% identity, 55% coverage: 50:266/397 of query aligns to 26:240/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
40% identity, 55% coverage: 50:266/397 of query aligns to 26:240/242 of 3c41J
Sites not aligning to the query:
>207786 MicrobesOnline__882:207786
MSKLSIRNLTKIFGPHPEKALGLLEQGLGKEEIHRRTSHAVGVDRASFDVEEGEIVVVMG
LSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMPVDELRRLRQRSFGMVFQNFALFPHR
TVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAEWAASRPAQLSGGMQQRVGLARALSL
DPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQKTIVFISHDLDEALKLGDRIVLMRDG
AVVQIGTPEDILTNPADDYVARFVGEADVTKVLTAGSVMKRSEAVAVLGIDGPRTALRKM
RRNAIATLFVLDERHRLVGLITADDAARLAAEGVRELGSIVRRDIATVPPEAPATELISL
MADLPHPLAVVDERGRLAGVIVRGLLLGALAERGGVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory