Comparing 207809 MicrobesOnline__882:207809 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3gueA Crystal structure of udp-glucose phosphorylase from trypanosoma brucei, (tb10.389.0330)
41% identity, 94% coverage: 26:477/479 of query aligns to 11:464/468 of 3gueA
5nzmA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with murrayamine-i
40% identity, 96% coverage: 17:474/479 of query aligns to 5:477/483 of 5nzmA
5nzlA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with resveratrol
40% identity, 96% coverage: 17:474/479 of query aligns to 5:477/483 of 5nzlA
5nzkA Crystal structure of udp-glucose pyrophosphorylase from leishmania major in complex with phenylalanine
40% identity, 96% coverage: 17:474/479 of query aligns to 5:477/483 of 5nzkA
4m28A Udp-glucose pyrophosphorylase from leishmania major in complex with utp analog dupcpp
40% identity, 96% coverage: 17:474/479 of query aligns to 5:477/483 of 4m28A
2oegA Open and closed structures of the udp-glucose pyrophosphorylase from leishmania major (see paper)
40% identity, 96% coverage: 17:474/479 of query aligns to 4:476/482 of 2oegA
P32861 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
39% identity, 85% coverage: 71:477/479 of query aligns to 83:489/499 of P32861
Q16851 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Homo sapiens (Human) (see 6 papers)
38% identity, 82% coverage: 83:477/479 of query aligns to 104:498/508 of Q16851
Sites not aligning to the query:
4r7pB Human udp-glucose pyrophosphorylase isoform 1 in complex with udp- glucose (see paper)
38% identity, 82% coverage: 83:477/479 of query aligns to 81:475/485 of 4r7pB
4r7pA Human udp-glucose pyrophosphorylase isoform 1 in complex with udp- glucose (see paper)
38% identity, 82% coverage: 83:477/479 of query aligns to 81:475/485 of 4r7pA
P19595 UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Solanum tuberosum (Potato) (see 2 papers)
39% identity, 80% coverage: 93:476/479 of query aligns to 93:469/477 of P19595
Sites not aligning to the query:
Q9M9P3 UTP--glucose-1-phosphate uridylyltransferase 2; UDP-glucose pyrophosphorylase 2; AtUGP2; UDPGP 2; UGPase 2; EC 2.7.7.9 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 79% coverage: 93:469/479 of query aligns to 86:454/469 of Q9M9P3
Sites not aligning to the query:
2icyB Crystal structure of a putative udp-glucose pyrophosphorylase from arabidopsis thaliana with bound udp-glucose (see paper)
38% identity, 79% coverage: 93:469/479 of query aligns to 80:448/463 of 2icyB
Sites not aligning to the query:
2icxA Crystal structure of a putative udp-glucose pyrophosphorylase from arabidopsis thaliana with bound utp (see paper)
38% identity, 79% coverage: 93:469/479 of query aligns to 74:440/455 of 2icxA
Sites not aligning to the query:
P78811 Probable UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose pyrophosphorylase; UDPGP; UGPase; EC 2.7.7.9 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 87% coverage: 63:477/479 of query aligns to 86:496/506 of P78811
Sites not aligning to the query:
3oh1A Protein structure of usp from l. Major bound to uridine-5'- diphosphate-galacturonic acid (see paper)
26% identity, 61% coverage: 80:373/479 of query aligns to 106:406/582 of 3oh1A
3oh2A Protein structure of usp from l. Major bound to uridine-5'- diphosphate-galactose (see paper)
25% identity, 61% coverage: 80:373/479 of query aligns to 106:407/579 of 3oh2A
3oh4A Protein structure of usp from l. Major bound to uridine-5'-diphosphate glucose (see paper)
25% identity, 61% coverage: 80:373/479 of query aligns to 106:409/585 of 3oh4A
3oh3A Protein structure of usp from l. Major bound to uridine-5'-diphosphate -arabinose (see paper)
25% identity, 61% coverage: 80:373/479 of query aligns to 106:409/585 of 3oh3A
3oh0A Protein structure of usp from l. Major bound to uridine-5'- triphosphate (see paper)
25% identity, 61% coverage: 80:373/479 of query aligns to 106:409/585 of 3oh0A
>207809 MicrobesOnline__882:207809
MESSAPMSPRPEHATHSARESFSRLMREERLPGELIDLFLGYHGEIEASHTGLIGENDIL
PAKVEDFTHLDSLTRYAPEGRKLMHRAVCIRLNGGLGTSMGMTHAKSLLPARHDRSFLDI
IHGQAEHQRKAHGGASPLLFMNSYATHADTLRALESMAAPEHMPRCFLQHRFPKVDRATL
LPVRSHEAGDMAWNPPGHGDIYAALVLSGMLDALLSEGRRWALVANADNLGASLDPAILG
YMAAHRIPFLMECARRTPADSKGGHLARTPEGGLVLREVAQCPADDMAHFQDIHRYGLFN
TNNIWLDLAALRDRVERYGLLRLPLILNPKTLDPRDPESTPVWQVETAMGAAIALFPGAT
AIVTPRRRFLPVKRCNDLLLLWSDCFSLGEDFHLNRRVAHDSPLPRIDLDPKHYGTWDRL
MQRFPHGAPAMRSCTAMQVRGDVRFGDDVALDGEVRIRNSAKAQAVIPDGTRLSGEVHL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory