Comparing 207829 MicrobesOnline__882:207829 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
42% identity, 86% coverage: 25:257/270 of query aligns to 6:239/243 of 5eyfB
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
44% identity, 83% coverage: 31:254/270 of query aligns to 3:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
44% identity, 83% coverage: 31:253/270 of query aligns to 3:226/226 of 4zv1A
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
36% identity, 87% coverage: 17:252/270 of query aligns to 1:246/278 of 2ia4B
2vhaA Debp (see paper)
36% identity, 87% coverage: 18:252/270 of query aligns to 1:245/276 of 2vhaA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
35% identity, 88% coverage: 16:252/270 of query aligns to 37:272/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
35% identity, 88% coverage: 16:252/270 of query aligns to 36:271/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
35% identity, 88% coverage: 16:252/270 of query aligns to 36:271/287 of 6h1uA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
34% identity, 86% coverage: 20:252/270 of query aligns to 1:243/503 of 8ovoA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
36% identity, 85% coverage: 25:254/270 of query aligns to 3:229/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
36% identity, 84% coverage: 25:252/270 of query aligns to 3:228/229 of 5t0wA
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
32% identity, 80% coverage: 23:237/270 of query aligns to 1:217/231 of 2v25A
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
32% identity, 82% coverage: 32:252/270 of query aligns to 1:222/224 of 4ymxA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
33% identity, 83% coverage: 34:257/270 of query aligns to 5:226/226 of 8eyzA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
31% identity, 83% coverage: 21:243/270 of query aligns to 4:230/324 of 4z9nB
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
30% identity, 86% coverage: 25:257/270 of query aligns to 6:235/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
30% identity, 86% coverage: 25:257/270 of query aligns to 10:239/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
30% identity, 86% coverage: 25:257/270 of query aligns to 10:239/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
30% identity, 86% coverage: 25:257/270 of query aligns to 10:239/241 of 3vvdA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 83% coverage: 34:257/270 of query aligns to 3:225/231 of 2q2cA
>207829 MicrobesOnline__882:207829
MKRLLLLALTLGLVLTAAVAHAGKLDEIKQRGTLVCGVKDSVVPFGFIDETSKQLVGFDV
DICQFIADRAGVKLEVKTVTSATRIPMLTQGSVDLVAATMTHKFERDDVIDFSITYFDAG
QRLLVKKGGGIKSAADLKGKKVATVKGSTSEKNMKAAQPDCVVVSFDEYPQAFLALKQGK
AEAVTTDEPILVGLKNSDPEPDKWDIVGDFIASEPYGLGLVENDSKFRDFVNKSLAEMWT
TGAYQKSYDKWFGKDTKYFIPLKWKMEVWP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory