SitesBLAST
Comparing 207852 MicrobesOnline__882:207852 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
45% identity, 99% coverage: 3:387/388 of query aligns to 10:395/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I15), R23 (= R16), G39 (= G32), G40 (= G33), G99 (= G97), S100 (= S98), Q101 (= Q99), Y125 (= Y123), N174 (= N170), D202 (= D198), Y205 (= Y201), S235 (= S227), S237 (= S229), K238 (= K230), R245 (= R237), R368 (= R360)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
45% identity, 99% coverage: 3:387/388 of query aligns to 10:395/397 of Q72LL6
- S20 (= S13) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R16) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G33) binding
- Y70 (= Y63) binding
- N174 (= N170) binding ; binding
- R245 (= R237) binding
- R368 (= R360) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
45% identity, 99% coverage: 3:387/388 of query aligns to 6:391/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I15), R19 (= R16), G35 (= G32), G36 (= G33), G95 (= G97), S96 (= S98), Q97 (= Q99), Y121 (= Y123), N170 (= N170), D198 (= D198), Y201 (= Y201), S231 (= S227), S233 (= S229), K234 (= K230), R241 (= R237), R364 (= R360)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
45% identity, 99% coverage: 3:387/388 of query aligns to 6:391/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G97), S96 (= S98), Q97 (= Q99), Y121 (= Y123), N170 (= N170), D198 (= D198), A200 (≠ P200), Y201 (= Y201), S231 (= S227), S233 (= S229), K234 (= K230), R241 (= R237)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
41% identity, 99% coverage: 4:386/388 of query aligns to 11:402/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R16), G40 (= G33), L41 (= L34)
- binding 2-oxoglutaric acid: D213 (≠ N199), P214 (= P200), Y215 (= Y201), G216 (= G202), E217 (= E203), G241 (= G226), T242 (≠ S227), I246 (≠ V231)
- binding (2E)-pent-2-enedioic acid: G40 (= G33), Y130 (= Y123), N184 (= N170), R376 (= R360)
- binding glutamic acid: S20 (= S13), V22 (≠ I15), L131 (= L124), V360 (= V345), A364 (≠ P349), R369 (vs. gap)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G97), S105 (= S98), Q106 (= Q99), Y130 (= Y123), N184 (= N170), D212 (= D198), P214 (= P200), Y215 (= Y201), T242 (≠ S227), S244 (= S229), K245 (= K230), R252 (= R237)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
41% identity, 99% coverage: 4:386/388 of query aligns to 11:402/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S13), V22 (≠ I15), R23 (= R16), L131 (= L124), Q135 (= Q128), A364 (≠ P349), R369 (vs. gap)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R16), G40 (= G33), Y130 (= Y123), L131 (= L124), A132 (≠ G125), N184 (= N170), R376 (= R360)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G97), S105 (= S98), Q106 (= Q99), Y130 (= Y123), V179 (= V165), N184 (= N170), D212 (= D198), P214 (= P200), Y215 (= Y201), T242 (≠ S227), S244 (= S229), K245 (= K230), R252 (= R237)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
41% identity, 99% coverage: 4:386/388 of query aligns to 11:402/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R16), Y70 (= Y63), Y130 (= Y123), L275 (= L260)
- binding pyridoxal-5'-phosphate: G104 (= G97), S105 (= S98), Q106 (= Q99), Y130 (= Y123), V179 (= V165), N184 (= N170), D212 (= D198), P214 (= P200), Y215 (= Y201), T242 (≠ S227), S244 (= S229), K245 (= K230), R252 (= R237)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
41% identity, 99% coverage: 4:386/388 of query aligns to 11:402/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G97), S105 (= S98), Q106 (= Q99), Y130 (= Y123), V179 (= V165), N184 (= N170), D212 (= D198), P214 (= P200), Y215 (= Y201), T242 (≠ S227), S244 (= S229), K245 (= K230), R252 (= R237)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
45% identity, 99% coverage: 3:387/388 of query aligns to 7:387/389 of 2z1yA
- binding leucine: G32 (= G33), Y117 (= Y123), R360 (= R360)
- binding pyridoxal-5'-phosphate: G91 (= G97), S92 (= S98), Q93 (= Q99), Y117 (= Y123), N166 (= N170), D194 (= D198), Y197 (= Y201), S227 (= S227), S229 (= S229), K230 (= K230), R237 (= R237)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
40% identity, 98% coverage: 10:388/388 of query aligns to 14:402/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G97), S103 (= S98), Q104 (= Q99), Y128 (= Y123), V177 (= V165), N182 (= N170), D210 (= D198), P212 (= P200), Y213 (= Y201), T240 (≠ S227), S242 (= S229), K243 (= K230), R250 (= R237)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
39% identity, 99% coverage: 2:384/388 of query aligns to 15:412/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G97), S113 (= S98), Q114 (= Q99), Y138 (= Y123), N194 (= N170), D222 (= D198), P224 (= P200), Y225 (= Y201), T252 (≠ S227), S254 (= S229), K255 (= K230), R262 (= R237)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
32% identity, 93% coverage: 27:386/388 of query aligns to 36:405/405 of 2zc0A
- active site: Y132 (= Y123), D214 (= D198), A216 (≠ P200), S246 (= S229)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G97), G107 (≠ S98), T108 (≠ Q99), Y132 (= Y123), N186 (= N170), D214 (= D198), A216 (≠ P200), Y217 (= Y201), T244 (≠ S227), S246 (= S229), K247 (= K230), R254 (= R237)
3ue8A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 13:386/388 of query aligns to 2:408/410 of 3ue8A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G22 (= G33), Y57 (= Y63), S100 (= S98), Q101 (= Q99), Y125 (= Y123), N185 (= N170), D213 (= D198), P215 (= P200), Y216 (= Y201), S243 (= S227), S245 (= S229), K246 (= K230), R253 (= R237), R382 (= R360)
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
27% identity, 97% coverage: 12:386/388 of query aligns to 3:414/414 of 2vgzA
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 13:386/388 of query aligns to 17:425/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G33), L40 (= L34), Y74 (= Y63), S117 (= S98), Q118 (= Q99), Y142 (= Y123), N202 (= N170), D230 (= D198), P232 (= P200), Y233 (= Y201), S260 (= S227), S262 (= S229), K263 (= K230), R270 (= R237), R399 (= R360)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 13:386/388 of query aligns to 17:425/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), R20 (= R16), T23 (≠ L19), G39 (= G33), L40 (= L34), Y74 (= Y63), S75 (= S64), S77 (≠ T66), S117 (= S98), Q118 (= Q99), Y142 (= Y123), N202 (= N170), D230 (= D198), P232 (= P200), Y233 (= Y201), S260 (= S227), S262 (= S229), R270 (= R237), L293 (= L260), R399 (= R360)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
27% identity, 96% coverage: 13:386/388 of query aligns to 17:425/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), G39 (= G33), Y74 (= Y63), S75 (= S64), S77 (≠ T66), S117 (= S98), Q118 (= Q99), Y142 (= Y123), N202 (= N170), D230 (= D198), P232 (= P200), Y233 (= Y201), S260 (= S227), S262 (= S229), R270 (= R237), L293 (= L260), R399 (= R360)
4gdyB Kynurenine aminotransferase ii inhibitors
27% identity, 96% coverage: 13:386/388 of query aligns to 17:425/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I15), M33 (≠ I27), G39 (= G33), Y74 (= Y63), S75 (= S64), G116 (= G97), S117 (= S98), Q118 (= Q99), Y142 (= Y123), N202 (= N170), D230 (= D198), P232 (= P200), S260 (= S227), S262 (= S229), R270 (= R237), R399 (= R360)
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
27% identity, 97% coverage: 12:386/388 of query aligns to 1:412/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: G26 (= G33), L27 (= L34), Y61 (= Y63), L280 (= L260)
- binding pyridoxal-5'-phosphate: S104 (= S98), Q105 (= Q99), Y129 (= Y123), D217 (= D198), P219 (= P200), S247 (= S227), S249 (= S229), R257 (= R237)
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
27% identity, 96% coverage: 13:386/388 of query aligns to 20:428/428 of 6t8qA
Query Sequence
>207852 MicrobesOnline__882:207852
MQIAKRMDNVQRSYIREILKVTARPDIISFAGGLPHPDSFPVQGVAEAAAAVLAESGSEA
LQYSTTEGYLPLREWISARYARQGIEVSPDEILITTGSQQALDLVAKTTIDRGAPVVIER
PGYLGAIQCFSFYGAQFRTVDLTPLGVDVEALRREAKGARLFYAVPSFQNPSGITYDEPT
RREVAAIMAETGCMLVEDNPYGELRFMGTPVAPIRKWAESPSVLLGSFSKVVSPGLRIGW
ACAPAELMRHMVTAKQASDLHTPMFTQRLLHRFLVDNDVDEHIASIRKRYGAQRQCMMDA
IRKHFPECVTVTEPEGGMFLWCGLPEGVTSEHLFHKAIERKVAFVPGCPFYVDGTDTGFR
LNFSNASQDDIVEGIARLGACLTEELAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory