Comparing 207875 MicrobesOnline__882:207875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
38% identity, 44% coverage: 5:263/592 of query aligns to 3:261/330 of P0AAH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 40% coverage: 32:266/592 of query aligns to 25:259/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
39% identity, 39% coverage: 32:263/592 of query aligns to 26:257/326 of Q8RDH4
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 39% coverage: 30:261/592 of query aligns to 21:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 39% coverage: 30:261/592 of query aligns to 22:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 39% coverage: 30:261/592 of query aligns to 22:242/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 39% coverage: 30:261/592 of query aligns to 22:242/344 of 6cvlD
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 39% coverage: 29:261/592 of query aligns to 18:238/242 of 3c4jA
Sites not aligning to the query:
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 39% coverage: 29:261/592 of query aligns to 18:238/242 of 3c41J
Sites not aligning to the query:
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 39% coverage: 29:261/592 of query aligns to 18:238/242 of 2olkA
Sites not aligning to the query:
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 39% coverage: 29:261/592 of query aligns to 18:238/242 of 2oljA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
39% identity, 38% coverage: 319:541/592 of query aligns to 28:240/241 of 4u00A
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 35% coverage: 30:235/592 of query aligns to 21:220/232 of 1f3oA
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 35% coverage: 30:235/592 of query aligns to 21:220/230 of 1l2tA
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 43% coverage: 5:261/592 of query aligns to 1:236/240 of 4ymuJ
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
36% identity, 40% coverage: 282:515/592 of query aligns to 1:215/276 of Q5M243
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 39% coverage: 312:541/592 of query aligns to 22:248/250 of 7z18I
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 39% coverage: 312:541/592 of query aligns to 22:248/253 of 7z15I
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
33% identity, 40% coverage: 301:538/592 of query aligns to 33:264/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
33% identity, 40% coverage: 301:538/592 of query aligns to 33:264/382 of 7aheC
Sites not aligning to the query:
>207875 MicrobesOnline__882:207875
MTHDLLHIEDLHLAFGGSAHPPAASGRAVLHGVGLTMRRGEIHALVGASGSGKSLTARAV
LGLLPPGARLTHGNIRFEGAQLAHAPESALRALRGDRIGMVFQDPLSSLNPLHTIERQVA
EPLAIHKGIRGPRARARALELLDMVGLDEPEARLASYPHQLSGGQRQRVALAMALANDPA
LLIADEPTTALDTTVQSQILRLIDTLRHRLGMGVLIVSHDLGVVRSLADVIHVMDAGCIV
ESAPTTRIFSAPASPVTRALLGAEGPSGPAPLPETTATQPALLEARDMGVTFTRQRGLFG
LRKTGHDALVSASFTLRRGECLGVVGESGSGKSTLALAVLRLIASRGRVTLDGQRLDTLD
EEALRPLRRKVQAVFQDPFSALNPRMTVAESIAEGLTTHFPDLRGRQGLKAMHDKTLAAL
DEVGLSDDFMQRYPGELSGGQCQRVVIARALALRPEVLVLDEPTSSLDRALQFQVVALLR
DLQLRHGMACLFITHDLSLVRSFCHRVMVLHRGHVVEAGPTPVVLDAPATATTRALVEAA
LGCAPASASGLSAATAEPTGLMVGRPRFAEMTPAHDAATPSNRRPRSDAAGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory