SitesBLAST
Comparing 207948 MicrobesOnline__882:207948 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
58% identity, 98% coverage: 4:313/316 of query aligns to 88:395/420 of Q8NBZ7
- G98 (= G14) binding
- F99 (= F15) binding
- V100 (= V16) binding
- D119 (= D35) binding
- N120 (= N36) binding
- F122 (= F38) binding
- T123 (= T39) binding
- G124 (= G40) binding
- D144 (= D60) binding
- V145 (≠ I61) binding
- L149 (= L65) binding
- Y150 (= Y66) binding
- L159 (= L75) binding
- S161 (≠ C77) binding
- K177 (= K93) binding
- T178 (= T94) binding
- N185 (= N101) binding
- G188 (= G104) binding
- K191 (= K107) binding
- R192 (= R108) binding
- A200 (= A116) binding
- E204 (= E120) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y147) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K151) binding
- R236 (= R152) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y161) binding
- Q248 (= Q164) binding
- E249 (≠ N165) binding
- T261 (= T177) binding
- H267 (= H183) binding
- R272 (= R188) binding
- R361 (= R279) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
58% identity, 98% coverage: 4:313/316 of query aligns to 1:308/312 of 2b69A
- active site: T115 (= T118), S116 (= S119), E117 (= E120), Y144 (= Y147), K148 (= K151), R185 (= R188)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), F12 (= F15), V13 (= V16), D32 (= D35), N33 (= N36), T36 (= T39), G37 (= G40), D57 (= D60), V58 (≠ I61), L72 (= L75), A73 (= A76), S74 (≠ C77), A76 (= A79), T91 (= T94), T115 (= T118), Y144 (= Y147), K148 (= K151), I171 (≠ L174), N173 (= N176), R185 (= R188)
- binding uridine-5'-diphosphate: P61 (= P64), L62 (= L65), Y63 (= Y66), P78 (= P81), N98 (= N101), G101 (= G104), L102 (= L105), K104 (= K107), R105 (= R108), Y158 (= Y161), N173 (= N176), R185 (= R188), V186 (= V189), N189 (= N192), T201 (= T204), Y203 (= Y206), Q208 (= Q211), R210 (= R213), I244 (= I249), D270 (= D275)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
58% identity, 97% coverage: 4:309/316 of query aligns to 86:389/418 of Q6GMI9
- R234 (= R152) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
51% identity, 98% coverage: 4:313/316 of query aligns to 1:270/274 of 4lk3B
- active site: T112 (= T118), S113 (= S119), E114 (= E120), K119 (= K151), R156 (= R188)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), F12 (= F15), V13 (= V16), D32 (= D35), N33 (= N36), T36 (= T39), G37 (= G40), D57 (= D60), V58 (≠ I61), L72 (= L75), A73 (= A76), S74 (≠ C77), P75 (= P78), T88 (= T94), A110 (= A116), T112 (= T118), K119 (= K151), I142 (≠ L174), H151 (= H183)
- binding uridine-5'-diphosphate: R156 (= R188), V157 (= V189), N160 (= N192), T172 (= T204), Y174 (= Y206), Q179 (= Q211), R181 (= R213), I215 (= I249)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P64), L62 (= L65), Y63 (= Y66), I83 (≠ V89), K87 (= K93), N95 (= N101), G98 (= G104), L99 (= L105), K101 (= K107), Y129 (= Y161), E133 (≠ N165)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
50% identity, 98% coverage: 4:313/316 of query aligns to 1:267/271 of 4lk3C
- active site: T110 (= T118), S111 (= S119), E112 (= E120), K117 (= K151), R154 (= R188)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), F12 (= F15), V13 (= V16), D32 (= D35), N33 (= N36), T36 (= T39), G37 (= G40), D57 (= D60), V58 (≠ I61), L72 (= L75), A73 (= A76), S74 (≠ C77), P75 (= P78), T86 (= T94), K117 (= K151), I140 (≠ L174), H149 (= H183)
- binding pyrophosphate 2-: R154 (= R188), V155 (= V189)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P64), L62 (= L65), Y63 (= Y66), N93 (= N101), G96 (= G104), L97 (= L105), K99 (= K107), R100 (= R108), Y127 (= Y161), E131 (≠ N165)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
45% identity, 55% coverage: 6:178/316 of query aligns to 1:132/164 of 4m55E
- active site: T105 (= T118)
- binding nicotinamide-adenine-dinucleotide: G6 (= G11), G9 (= G14), F10 (= F15), V11 (= V16), D30 (= D35), N31 (= N36), F32 (≠ Y37), T34 (= T39), G35 (= G40), D55 (= D60), V56 (≠ I61), S72 (≠ C77), P73 (= P78), T81 (= T94), T105 (= T118), T131 (= T177)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
32% identity, 97% coverage: 7:313/316 of query aligns to 3:308/309 of 4zrnA
- active site: T117 (≠ S117), G119 (≠ S119), A120 (≠ E120), Y143 (≠ I141), K147 (= K151), Y181 (vs. gap), G185 (≠ R188)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D31 (= D35), N32 (= N36), S34 (≠ F38), S35 (≠ T39), G36 (= G40), S51 (vs. gap), I52 (vs. gap), L73 (= L75), A74 (= A76), A75 (≠ C77), T92 (= T94), S115 (≠ Q115), S116 (≠ A116), Y143 (≠ I141), K147 (= K151), Y170 (≠ L174), V173 (≠ T177)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S117), G119 (≠ S119), A120 (≠ E120), Y143 (≠ I141), N172 (= N176), G185 (≠ R188), V186 (= V189), H201 (≠ T204), F203 (≠ Y206), Y208 (≠ Q211), R210 (= R213), V244 (≠ I249), R267 (≠ P272), D270 (= D275)
6h0pA The structure of c100a mutant of arabidopsis thaliana udp-apiose/udp- xylose synthase in complex with nadh and udp-d-glucuronic acid (see paper)
30% identity, 96% coverage: 7:308/316 of query aligns to 13:363/375 of 6h0pA
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), G20 (= G14), F21 (= F15), I22 (≠ V16), D42 (= D35), N69 (vs. gap), I70 (≠ V57), L89 (= L75), A90 (= A76), A91 (≠ C77), A93 (= A79), F130 (≠ A116), Y178 (= Y147), K182 (= K151)
- binding uridine-5'-diphosphate-glucuronic acid: P95 (= P81), Y98 (= Y84), T132 (= T118), E134 (= E120), R175 (vs. gap), Y178 (= Y147), N207 (= N176), R228 (= R188), V229 (= V189), C232 (≠ N192), F233 (= F193), V246 (≠ Y206), R253 (= R213), V291 (≠ I249), F323 (vs. gap), Y324 (vs. gap), Y328 (vs. gap), D330 (= D275), R334 (= R279)
6h0nA The structure of wild-type arabidopsis thaliana udp-apiose/udp-xylose synthase in complex with NAD+ and udp (see paper)
30% identity, 96% coverage: 7:308/316 of query aligns to 13:363/377 of 6h0nA
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), G20 (= G14), F21 (= F15), I22 (≠ V16), D42 (= D35), V43 (≠ N36), I68 (vs. gap), N69 (vs. gap), I70 (≠ V57), L89 (= L75), A90 (= A76), A91 (≠ C77), C93 (≠ A79), S131 (= S117), T132 (= T118), Y178 (= Y147), K182 (= K151), P205 (≠ L174), N207 (= N176), W208 (≠ T177), R228 (= R188)
- binding uridine-5'-diphosphate: P95 (= P81), R175 (vs. gap), R228 (= R188), V229 (= V189), C232 (≠ N192), V246 (≠ Y206), R253 (= R213), V291 (≠ I249), F323 (vs. gap), Y324 (vs. gap), Y328 (vs. gap), D330 (= D275), R334 (= R279)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
31% identity, 97% coverage: 5:311/316 of query aligns to 8:313/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G11), G17 (= G14), F18 (= F15), I19 (≠ V16), D37 (= D35), N38 (= N36), E40 (≠ F38), R41 (≠ T39), N61 (≠ D60), V62 (≠ I61), A81 (≠ L75), A82 (= A76), A83 (≠ C77), F124 (≠ A116), K154 (= K151), P177 (≠ L174), N179 (= N176)
- binding uridine-5'-diphosphate: R147 (= R144), G189 (= G187), A190 (≠ V189), M194 (≠ F193), Y205 (≠ T204), I206 (= I205), F207 (≠ Y206), R214 (= R213), I251 (= I249)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 97% coverage: 6:310/316 of query aligns to 2:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A79), R84 (≠ V82), S121 (= S117), G123 (≠ S119), Y146 (= Y147), A174 (≠ F175), N175 (= N176), A187 (≠ G187), G188 (≠ R188), V189 (= V189), F193 (= F193), R204 (≠ T204), F206 (≠ Y206), N211 (≠ Q211), R213 (= R213), D248 (≠ I249), R271 (≠ P272)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D31 (= D35), N32 (= N36), A34 (≠ F38), T35 (= T39), G36 (= G40), D56 (= D60), I57 (= I61), L77 (= L75), A78 (= A76), A79 (≠ C77), I81 (≠ A79), T119 (≠ Q115), Y146 (= Y147), K150 (= K151), P173 (≠ L174), A174 (≠ F175), V176 (≠ T177)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A79), R84 (≠ V82), S121 (= S117), G123 (≠ S119), Y146 (= Y147), A174 (≠ F175), N175 (= N176), A187 (≠ G187), G188 (≠ R188), V189 (= V189), F193 (= F193), R204 (≠ T204), F206 (≠ Y206), N211 (≠ Q211), R213 (= R213), D248 (≠ I249), R271 (≠ P272)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 97% coverage: 6:310/316 of query aligns to 2:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D31 (= D35), N32 (= N36), T35 (= T39), G36 (= G40), D56 (= D60), I57 (= I61), L77 (= L75), A78 (= A76), A79 (≠ C77), I81 (≠ A79), T119 (≠ Q115), Y146 (= Y147), K150 (= K151), P173 (≠ L174), N175 (= N176), V176 (≠ T177)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A79), R84 (≠ V82), S121 (= S117), G123 (≠ S119), S124 (≠ E120), Y146 (= Y147), A174 (≠ F175), N175 (= N176), G188 (≠ R188), V189 (= V189), F193 (= F193), R204 (≠ T204), V205 (≠ I205), F206 (≠ Y206), N211 (≠ Q211), R213 (= R213), D248 (≠ I249), R271 (≠ P272)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 97% coverage: 6:310/316 of query aligns to 2:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D31 (= D35), N32 (= N36), T35 (= T39), G36 (= G40), D56 (= D60), I57 (= I61), L77 (= L75), A78 (= A76), A79 (≠ C77), I81 (≠ A79), V96 (≠ T94), T119 (≠ Q115), Y146 (= Y147), K150 (= K151), P173 (≠ L174), A174 (≠ F175), N175 (= N176), V176 (≠ T177)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A79), R84 (≠ V82), S121 (= S117), G123 (≠ S119), Y146 (= Y147), A174 (≠ F175), N175 (= N176), A187 (≠ G187), G188 (≠ R188), V189 (= V189), F193 (= F193), R204 (≠ T204), V205 (≠ I205), F206 (≠ Y206), R213 (= R213), D248 (≠ I249), R271 (≠ P272)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
29% identity, 97% coverage: 6:312/316 of query aligns to 2:313/314 of 6zljA
- active site: T126 (= T118), S127 (= S119), S128 (≠ E120), F149 (≠ I141), K153 (= K151)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D32 (= D35), H33 (≠ N36), F34 (≠ Y37), I35 (≠ F38), K43 (≠ A41), D62 (= D60), I63 (= I61), L81 (= L75), A82 (= A76), A83 (≠ C77), I124 (≠ A116), T126 (= T118), K153 (= K151), Y176 (≠ L174), T178 (≠ N176), V179 (≠ T177), R185 (≠ H183), M188 (≠ R188)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P78), R88 (≠ P81), T126 (= T118), S127 (= S119), S128 (≠ E120), F149 (≠ I141), F177 (= F175), T178 (≠ N176), R185 (≠ H183), M188 (≠ R188), A189 (≠ V189), R192 (≠ N192), T204 (= T204), F206 (≠ Y206), Q211 (= Q211), R213 (= R213), I250 (= I249), E276 (≠ D275)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
29% identity, 97% coverage: 6:312/316 of query aligns to 2:313/321 of 6zllA
- active site: T126 (= T118), S127 (= S119), S128 (≠ E120), Y149 (≠ I141), K153 (= K151)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D32 (= D35), H33 (≠ N36), F34 (≠ Y37), I35 (≠ F38), K43 (≠ A41), D62 (= D60), I63 (= I61), L81 (= L75), A82 (= A76), A83 (≠ C77), I124 (≠ A116), T126 (= T118), Y149 (≠ I141), K153 (= K151), Y176 (≠ L174), V179 (≠ T177), R185 (≠ H183), M188 (≠ R188)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P78), V87 (≠ S80), R88 (≠ P81), T126 (= T118), S127 (= S119), Y149 (≠ I141), T178 (≠ N176), R185 (≠ H183), A189 (≠ V189), R192 (≠ N192), T204 (= T204), F206 (≠ Y206), Q211 (= Q211), R213 (= R213), I250 (= I249), E276 (≠ D275)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
29% identity, 97% coverage: 6:312/316 of query aligns to 2:313/314 of 6zldA
- active site: T126 (= T118), S127 (= S119), S128 (≠ E120), Y149 (≠ I141), K153 (= K151)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D32 (= D35), H33 (≠ N36), F34 (≠ Y37), I35 (≠ F38), K43 (≠ A41), D62 (= D60), I63 (= I61), L81 (= L75), A82 (= A76), A83 (≠ C77), I124 (≠ A116), T126 (= T118), K153 (= K151), Y176 (≠ L174), T178 (≠ N176), R185 (≠ H183), M188 (≠ R188)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P78), R88 (≠ P81), T126 (= T118), S127 (= S119), S128 (≠ E120), Y149 (≠ I141), F177 (= F175), T178 (≠ N176), R185 (≠ H183), M188 (≠ R188), A189 (≠ V189), R192 (≠ N192), T204 (= T204), F206 (≠ Y206), Q211 (= Q211), R213 (= R213), I250 (= I249), E276 (≠ D275)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
29% identity, 97% coverage: 6:312/316 of query aligns to 2:313/314 of 6zl6A
- active site: T126 (= T118), S127 (= S119), S128 (≠ E120), Y149 (≠ I141), K153 (= K151)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D32 (= D35), H33 (≠ N36), F34 (≠ Y37), I35 (≠ F38), K43 (≠ A41), D62 (= D60), I63 (= I61), L81 (= L75), A82 (= A76), A83 (≠ C77), I124 (≠ A116), T126 (= T118), K153 (= K151), Y176 (≠ L174), T178 (≠ N176), V179 (≠ T177), R185 (≠ H183), M188 (≠ R188)
- binding uridine-5'-diphosphate: T178 (≠ N176), A189 (≠ V189), R192 (≠ N192), T204 (= T204), F206 (≠ Y206), Q211 (= Q211), R213 (= R213), I250 (= I249), E276 (≠ D275)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
31% identity, 94% coverage: 5:302/316 of query aligns to 1:300/307 of 6wjaA
- active site: A118 (≠ T118), A119 (≠ S119), A120 (≠ E120), F143 (≠ Y147), K147 (= K151)
- binding nicotinamide-adenine-dinucleotide: G7 (= G11), G10 (= G14), F11 (= F15), I12 (≠ V16), D31 (= D35), D32 (≠ N36), S34 (≠ F38), T35 (= T39), G36 (= G40), A55 (≠ I61), L74 (= L75), A75 (= A76), A76 (≠ C77), S93 (≠ T94), F143 (≠ Y147), K147 (= K151), F170 (≠ L174), F171 (= F175), I173 (≠ T177)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (≠ P81), A120 (≠ E120), N172 (= N176), G186 (≠ R188), V187 (= V189), F191 (= F193), T202 (= T204), F204 (≠ Y206), R211 (= R213), L247 (≠ I249), R270 (≠ P272), D273 (= D275)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
31% identity, 94% coverage: 5:302/316 of query aligns to 2:301/308 of 6wj9B
- active site: A119 (≠ T118), A120 (≠ S119), A121 (≠ E120), F144 (≠ Y147), K148 (= K151)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), F12 (= F15), I13 (≠ V16), D32 (= D35), D33 (≠ N36), S35 (≠ F38), T36 (= T39), G37 (= G40), D55 (= D60), A56 (≠ I61), L75 (= L75), A76 (= A76), A77 (≠ C77), S94 (≠ T94), A117 (= A116), A119 (≠ T118), F144 (≠ Y147), K148 (= K151), F171 (≠ L174), F172 (= F175), I174 (≠ T177)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (≠ P81), N173 (= N176), G187 (≠ R188), V188 (= V189), F192 (= F193), T203 (= T204), L204 (≠ I205), F205 (≠ Y206), R212 (= R213), L248 (≠ I249), R271 (≠ P272), D274 (= D275)
Q93VR3 GDP-mannose 3,5-epimerase; GDP-Man 3,5-epimerase; EC 5.1.3.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 96% coverage: 6:309/316 of query aligns to 29:334/377 of Q93VR3
- 34:60 (vs. 11:42, 34% identical) binding
- D58 (= D35) binding
- D78 (≠ R58) binding
- C145 (≠ E120) mutation to A: Loss of activity.; mutation to S: Strong reduction of activity.
- Y174 (= Y147) binding ; mutation to F: Loss of activity.
- K178 (= K151) binding ; mutation to R: Strong reduction of activity.
- K217 (vs. gap) mutation to A: Loss of activity.
- R306 (= R279) mutation to A: Strong reduction of activity.
Query Sequence
>207948 MicrobesOnline__882:207948
MHLRKRVLVTGGAGFVGSHLCDRLLKDGHEVLCVDNYFTGARANVEHLLENRRFELVRHD
ITFPLYVEVDEIWNLACPASPVHYQHDPVQTIKTCVHGAINMLGLAKRVGARIFQASTSE
VYGDPAEHPQTENYWGNVDPIGIRSCYDEGKRCAEALFFAYHRQNGLDIRVGRLFNTYGP
RMHPNDGRVVSNFIMQALRNEPITIYGDGSQTRSFCYIHDLIECMIRFMDLPPGLHGPVN
IGNPAEFTIRELAETVIDLVGSRSTIAHLPLPSGDPRQRRPDISTVREKLGWEPQTQLRE
GLRHTIAYFQGMLAPS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory