Comparing 207964 MicrobesOnline__882:207964 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P0AAC6 Modulator of FtsH protease YccA from Escherichia coli (strain K12) (see 2 papers)
30% identity, 50% coverage: 117:233/233 of query aligns to 113:219/219 of P0AAC6
Sites not aligning to the query:
Q91VC9 Growth hormone-inducible transmembrane protein; Mitochondrial morphology and cristae structure 1; MICS1 from Mus musculus (Mouse) (see paper)
26% identity, 96% coverage: 11:233/233 of query aligns to 124:345/346 of Q91VC9
>207964 MicrobesOnline__882:207964
MYNRTMGSAARVEATNAYMRGVYSWMTLGLAVTAAAAWGVASSEALIAFIFGNTFVFFGL
IIAEFALVIGISAGIARLSAGMASGLFLLYSALNGLTLSSILLVYAQSAVFQAFITTAGM
FAVMSIYGATTKRDLTSMGSFLMMGLFGIILASVVNIFMRSSMMEFIISAVGVLVFTGLT
AYDTQKLKAFGENAPMDDAVAIRRGTILGALTLYLDFVNLFIMMVRLFGSSRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory