Comparing 207987 MicrobesOnline__882:207987 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
2yxoB Histidinol phosphate phosphatase complexed with sulfate (see paper)
31% identity, 99% coverage: 4:274/274 of query aligns to 2:263/265 of 2yxoB
2yz5A Histidinol phosphate phosphatase complexed with phosphate (see paper)
31% identity, 99% coverage: 4:274/274 of query aligns to 2:263/263 of 2yz5A
6nlrB Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes with trinuclear metals determined by pixe revealing sulphate ion in active site. Based on pixe analysis and original date from 3dcp (see paper)
27% identity, 89% coverage: 5:248/274 of query aligns to 4:271/273 of 6nlrB
6nlrA Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes with trinuclear metals determined by pixe revealing sulphate ion in active site. Based on pixe analysis and original date from 3dcp (see paper)
27% identity, 89% coverage: 5:248/274 of query aligns to 4:271/277 of 6nlrA
3dcpA Crystal structure of the putative histidinol phosphatase hisk from listeria monocytogenes. Northeast structural genomics consortium target lmr141.
27% identity, 89% coverage: 5:248/274 of query aligns to 4:271/277 of 3dcpA
>207987 MicrobesOnline__882:207987
MITIDLHTHTSHSHGQATVQEMFEAGCARGLLVHGFSEHSPRPSGYDYPKDYRDKLTRSF
PDYVEQVRTLAATYAPERTVLLGLEMDWLPGQEPFIDATIHRYDYDYVIGGIHFLGTWGF
DYTPDDWQGFSPEQTADIYVRYFESLRRMAASGMFDIAAHPDIIKIFSAAAFHDWLATDK
AKAVVRDALETMHTAGMAMEISSAGLRKPCKEIYPCPDIMRMAADIGLPVTFGSDAHCVN
TIGWGFDTLADYARGFGYTRSVWMRRGERFERPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory