SitesBLAST
Comparing 208056 MicrobesOnline__882:208056 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
49% identity, 81% coverage: 68:504/542 of query aligns to 12:444/448 of 3du4A
- active site: F17 (= F73), Y146 (= Y205), E217 (= E277), D251 (= D311), A254 (= A314), K280 (= K340), A417 (≠ V477)
- binding 7-keto-8-aminopelargonic acid: L82 (= L139), Y146 (= Y205), G315 (= G375), S317 (≠ T377), R410 (= R470)
- binding pyridoxal-5'-phosphate: S112 (= S169), G113 (= G170), A114 (≠ S171), Y146 (= Y205), H147 (= H206), E217 (= E277), D251 (= D311), V253 (= V313), A254 (= A314), K280 (= K340), H316 (= H376), S317 (≠ T377)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
49% identity, 81% coverage: 68:504/542 of query aligns to 12:444/448 of P53555
- GA 113:114 (≠ GS 170:171) binding
- Y146 (= Y205) binding
- K280 (= K340) modified: N6-(pyridoxal phosphate)lysine
- G315 (= G375) binding
- HS 316:317 (≠ HT 376:377) binding
- R410 (= R470) binding
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
45% identity, 81% coverage: 61:500/542 of query aligns to 5:433/438 of 6zhkA
6wnnA Bacillus subtilis bioa in complex with amino donor l-lys
46% identity, 81% coverage: 68:504/542 of query aligns to 9:416/420 of 6wnnA
- active site: F14 (= F73), Y143 (= Y205), D223 (= D311), K252 (= K340)
- binding (2S)-2-amino-6-[[3-hydroxy-2-methyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]hexanoic acid: F14 (= F73), W51 (= W111), S109 (= S169), G110 (= G170), A111 (≠ S171), Y143 (= Y205), H144 (= H206), D223 (= D311), V225 (= V313), K252 (= K340), R382 (= R470)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: H288 (= H376), S289 (≠ T377)
3dodA Crystal structure of plp bound 7,8-diaminopelargonic acid synthase in bacillus subtilis (see paper)
45% identity, 81% coverage: 68:504/542 of query aligns to 10:413/417 of 3dodA
- active site: F15 (= F73), E186 (= E277), D220 (= D311), A223 (= A314), K249 (= K340), A386 (≠ V477)
- binding pyridoxal-5'-phosphate: W52 (= W111), S110 (= S169), G111 (= G170), A112 (≠ S171), D220 (= D311), V222 (= V313), K249 (= K340), H285 (= H376), S286 (≠ T377)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 80% coverage: 70:500/542 of query aligns to 13:445/449 of 5lh9D
- active site: Y148 (= Y205), D255 (= D311), K284 (= K340), T321 (= T377)
- binding pyridoxal-5'-phosphate: G115 (= G170), S116 (= S171), Y148 (= Y205), H149 (= H206), G150 (= G207), E222 (≠ P278), D255 (= D311), V257 (= V313), K284 (= K340)
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 80% coverage: 70:500/542 of query aligns to 11:443/447 of 5lhaA
- active site: Y146 (= Y205), D253 (= D311), K282 (= K340), T319 (= T377)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G170), S114 (= S171), Y146 (= Y205), H147 (= H206), G148 (= G207), E220 (≠ P278), D253 (= D311), K282 (= K340), Y318 (≠ H376), T319 (= T377)
6ed7A Crystal structure of 7,8-diaminopelargonic acid synthase bound to inhibitor mac13772
38% identity, 81% coverage: 63:500/542 of query aligns to 7:421/429 of 6ed7A
- active site: Y17 (≠ F73), Y144 (= Y205), D245 (= D311), K274 (= K340)
- binding 2-[(2-nitrophenyl)sulfanyl]acetohydrazide: Y17 (≠ F73), W52 (≠ L110), W52 (≠ L110), Y144 (= Y205), D147 (= D208), A217 (= A283), K274 (= K340), R391 (= R470), F393 (≠ L472), F393 (≠ L472)
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (= S171), Y144 (= Y205), H145 (= H206), D245 (= D311), I247 (≠ V313), K274 (= K340)
P12995 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Escherichia coli (strain K12) (see 4 papers)
38% identity, 81% coverage: 63:500/542 of query aligns to 7:421/429 of P12995
- Y17 (≠ F73) mutation to F: Severely reduces the aminotransferase activity.
- W52 (≠ L110) binding
- GS 112:113 (= GS 170:171) binding
- Y144 (= Y205) mutation to F: Severely reduces the aminotransferase activity.
- D147 (= D208) mutation to N: Loss of aminotransferase activity.
- D245 (= D311) binding
- R253 (≠ K319) mutation to A: Has only a small effect on the rate of reaction with DAPA.; mutation to K: Increases aminotransferase activity toward SAM.; mutation to M: Loss of aminotransferase activity.; mutation to Q: Increases aminotransferase activity toward SAM.
- K274 (= K340) binding ; modified: N6-(pyridoxal phosphate)lysine
- G307 (= G375) binding
- PT 308:309 (≠ HT 376:377) binding
- R391 (= R470) binding ; mutation to A: Reduces aminotransferase activity.
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
38% identity, 81% coverage: 63:500/542 of query aligns to 7:420/427 of 1mlzA
- active site: Y17 (≠ F73), Y144 (= Y205), E210 (= E277), D244 (= D311), A247 (= A314), K273 (= K340), Y397 (≠ V477)
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (= S171), Y144 (= Y205), H145 (= H206), D244 (= D311), I246 (≠ V313), K273 (= K340), P307 (≠ H376), T308 (= T377)
- binding trans-amiclenomycin: W52 (≠ L110), W53 (= W111), Y144 (= Y205), K273 (= K340), R390 (= R470), F392 (≠ L472)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
38% identity, 81% coverage: 63:500/542 of query aligns to 7:420/427 of 1mlyA
- active site: Y17 (≠ F73), Y144 (= Y205), E210 (= E277), D244 (= D311), A247 (= A314), K273 (= K340), Y397 (≠ V477)
- binding cis-amiclenomycin: W52 (≠ L110), W53 (= W111), K273 (= K340), R390 (= R470), F392 (≠ L472)
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (= S171), Y144 (= Y205), H145 (= H206), D244 (= D311), I246 (≠ V313), K273 (= K340), P307 (≠ H376), T308 (= T377)
1dtyA Crystal structure of adenosylmethionine-8-amino-7-oxonanoate aminotransferase with pyridoxal phosphate cofactor.
37% identity, 81% coverage: 63:500/542 of query aligns to 7:421/429 of 1dtyA
- active site: Y17 (≠ F73), Y144 (= Y205), E211 (= E277), D245 (= D311), A248 (= A314), K274 (= K340), Y398 (≠ V477)
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (= S171), Y144 (= Y205), H145 (= H206), D245 (= D311), I247 (≠ V313), K274 (= K340)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
35% identity, 82% coverage: 59:500/542 of query aligns to 6:443/448 of 6io1B
- active site: L20 (≠ F73), Y151 (= Y205), D257 (= D311), K286 (= K340)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S169), G118 (= G170), A119 (≠ S171), N122 (≠ V174), Y151 (= Y205), H152 (= H206), D257 (= D311), V259 (= V313), I260 (≠ A314), K286 (= K340)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
37% identity, 81% coverage: 63:500/542 of query aligns to 7:409/416 of 1qj3A
- active site: Y17 (≠ F73), Y144 (= Y205), E201 (= E277), D235 (= D311), A238 (= A314), K264 (= K340), Y386 (≠ V477)
- binding 7-keto-8-aminopelargonic acid: Y17 (≠ F73), W52 (≠ L110), Y144 (= Y205), K264 (= K340), R379 (= R470), F381 (≠ L472)
- binding pyridoxal-5'-phosphate: G112 (= G170), S113 (= S171), Y144 (= Y205), H145 (= H206), G146 (= G207), D235 (= D311), I237 (≠ V313), A238 (= A314), K264 (= K340)
6s54A Transaminase from pseudomonas fluorescens (see paper)
31% identity, 83% coverage: 55:502/542 of query aligns to 2:450/453 of 6s54A
- active site: M20 (≠ F73), Y152 (= Y205), D258 (= D311), K287 (= K340)
- binding pyridoxal-5'-phosphate: G119 (= G170), S120 (= S171), Y152 (= Y205), H153 (= H206), G154 (= G207), E225 (≠ P278), D258 (= D311), V260 (= V313), I261 (≠ A314), K287 (= K340)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
38% identity, 80% coverage: 60:492/542 of query aligns to 5:412/425 of 4w1vA
- active site: Y18 (≠ F73), Y147 (= Y205), E210 (= E277), D244 (= D311), A247 (= A314), K273 (= K340), Y397 (≠ V477)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P72), Y18 (≠ F73), W54 (≠ L110), M81 (≠ T137), G83 (≠ L139), Y147 (= Y205), G306 (= G375), P307 (≠ H376), T308 (= T377), F392 (≠ L472)
- binding pyridoxal-5'-phosphate: G114 (= G170), S115 (= S171), Y147 (= Y205), H148 (= H206), E210 (= E277), D244 (= D311), I246 (≠ V313), K273 (= K340)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
38% identity, 80% coverage: 60:492/542 of query aligns to 5:412/425 of 4cxrA
- active site: Y18 (≠ F73), Y147 (= Y205), E210 (= E277), D244 (= D311), A247 (= A314), K273 (= K340), Y397 (≠ V477)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (≠ F73), W54 (≠ L110), W55 (= W111), A216 (= A283)
- binding pyridoxal-5'-phosphate: G114 (= G170), S115 (= S171), Y147 (= Y205), H148 (= H206), E210 (= E277), D244 (= D311), I246 (≠ V313), K273 (= K340), P307 (≠ H376), T308 (= T377)
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
32% identity, 83% coverage: 58:505/542 of query aligns to 6:458/460 of 5kr6B
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
34% identity, 80% coverage: 64:497/542 of query aligns to 9:432/439 of Q9A3Q9
- V227 (≠ M286) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (≠ K319) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (≠ G344) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
38% identity, 80% coverage: 60:492/542 of query aligns to 5:414/427 of 4cxqA
- active site: Y18 (≠ F73), Y149 (= Y205), E212 (= E277), D246 (= D311), A249 (= A314), K275 (= K340), Y399 (≠ V477)
- binding 7-keto-8-aminopelargonic acid: W56 (≠ L110), Y149 (= Y205), G308 (= G375), T310 (= T377), R392 (= R470)
- binding pyridoxal-5'-phosphate: G116 (= G170), S117 (= S171), Y149 (= Y205), H150 (= H206), G151 (= G207), E212 (= E277), D246 (= D311), I248 (≠ V313), K275 (= K340), P309 (≠ H376), T310 (= T377)
Query Sequence
>208056 MicrobesOnline__882:208056
MSTSPFNSRVAPMPHDDATAPVLHYAHDAAGAHDAADAAGAHDAADAAGTPPCAASRTAR
LRSLDAAHVWHPFTQMRDWMGSEPCIIDAADGNHLIDTDGNRYLDGVSSLWTNVHGHRHP
HIDEAIRRQLDRVAHSTLLGLGGTPSIELAARLTAIAPAGLTRVFYSDSGSTAVEAALKI
AFQYHRQAPEGDARRTRVMAFSNAYHGDTIGSVSLGGMSLFHGIYGPLLFDPVRAPAPHC
YRCPADLRPETCGMACLGEVERLMRHHGHELCAVVVEPLVQGAAGMLVQPRGWLRGLRDL
CDRHGVFMVADEVAVGFGKTGTMFACEQEGVVPDMLCLAKGITGGYLPLAATLVTEHIHD
GFLGGYADFRTFFHGHTYTGNALACAAALASLDVFEEERTLETLRPRIERLATLLAPLND
LPHVGDIRRVGVMTGIELVADRETRTPYRPEERIGHRVTLEARRRGVIVRPLGDVMVLMP
PLSITETELETLVHTVRGAIIAVTEHGADGGLWTKRPDGPDNPDKANTPDTPDGARTGET
VV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory