Comparing 208063 FitnessBrowser__DvH:208063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
37% identity, 93% coverage: 22:412/421 of query aligns to 6:380/386 of Q9X1K5
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
37% identity, 93% coverage: 22:412/421 of query aligns to 5:379/385 of 2yxxA
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
34% identity, 96% coverage: 6:409/421 of query aligns to 6:410/419 of 1ko0A
1knwA Crystal structure of diaminopimelate decarboxylase
34% identity, 96% coverage: 6:409/421 of query aligns to 6:410/421 of 1knwA
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
34% identity, 97% coverage: 1:409/421 of query aligns to 1:411/420 of P00861
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 98% coverage: 2:415/421 of query aligns to 9:444/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
35% identity, 98% coverage: 2:415/421 of query aligns to 8:443/446 of 1hkvA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 93% coverage: 22:414/421 of query aligns to 27:429/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
33% identity, 93% coverage: 22:414/421 of query aligns to 23:425/434 of 1tufA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
33% identity, 93% coverage: 22:414/421 of query aligns to 23:425/434 of 1twiA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
33% identity, 93% coverage: 22:412/421 of query aligns to 20:409/418 of 4xg1B
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
31% identity, 93% coverage: 30:419/421 of query aligns to 31:422/422 of 6n2aA
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
32% identity, 94% coverage: 22:417/421 of query aligns to 4:391/394 of 3c5qA
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
31% identity, 94% coverage: 22:417/421 of query aligns to 6:399/405 of B4XMC6
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 22:415/421 of query aligns to 34:441/442 of 5x7nA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
33% identity, 94% coverage: 22:415/421 of query aligns to 34:441/443 of 5x7mA
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
30% identity, 93% coverage: 22:412/421 of query aligns to 18:384/393 of 4xg1A
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
28% identity, 94% coverage: 21:414/421 of query aligns to 9:408/412 of 7ru7A
8d5dA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- arginine (see paper)
28% identity, 93% coverage: 23:413/421 of query aligns to 39:450/458 of 8d5dA
8d5rA Structure of y430f d-ornithine/d-lysine decarboxylase complex with d- ornithine (see paper)
28% identity, 93% coverage: 23:413/421 of query aligns to 40:452/461 of 8d5rA
>208063 FitnessBrowser__DvH:208063
MPNVRSTYTDAVGFFGLTSPTELVETYGSPLYVYSEAILRQRCREMKALSSHPGFRVNYS
AKANSNLALLHIIREEGLVVDAMSPGELFMNLRAGFSPDKILYVCNNVSAEELGNAVSHG
LLVSVDSLSQLDLYGEVNPGGRVMVRFNPGIGAGHHKKVVTAGKETKFGVDPASIDEVRT
ILARHNLTLAGINQHIGSLFLEPESYVEAARFLLTLAERFDDVEVIDFGGGFGIPYHKYD
NQPRLDLTAMGAQFDDLISGWAQRRGYRGRFLVEPGRYVVAECGLLLGSVHSVKSNGANR
YVGTDLGFNVLARPVMYDAHHDIEVYREDGAPSDLLLPQTVVGNICESGDIIARNRPLPP
VEEGDILGVLDAGAYGYVMSSSYNQRMRPAEVLIDLEGRPRLVRRRETLDDLVAMYEGLG
L
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory