Comparing 208065 DVU2568 peptidase, M20/M25/M40 family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
40% identity, 92% coverage: 28:404/412 of query aligns to 8:377/380 of P54955
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
38% identity, 89% coverage: 27:393/412 of query aligns to 13:378/389 of 4ewtA
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 87% coverage: 34:392/412 of query aligns to 56:416/442 of P54968
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 87% coverage: 34:392/412 of query aligns to 52:412/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
35% identity, 78% coverage: 35:354/412 of query aligns to 24:341/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
26% identity, 74% coverage: 31:335/412 of query aligns to 21:300/391 of 3ramA
Sites not aligning to the query:
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
28% identity, 53% coverage: 81:298/412 of query aligns to 56:277/377 of 7t1qA
Sites not aligning to the query:
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
23% identity, 81% coverage: 27:361/412 of query aligns to 2:334/375 of 4pqaA
Sites not aligning to the query:
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
23% identity, 81% coverage: 27:361/412 of query aligns to 2:334/376 of 4o23A
>208065 DVU2568 peptidase, M20/M25/M40 family
MSGHTAHSGTRHPHTGATVQRLAAEVESHIIAHRRALHAIPETGFEERCTAAYVAETLSG
LGLPVRTGIATTGVTALLDTGLEGPVVMLRADMDALPVTEATGLPFASRHEGRMHACGHD
AHMAMLLGAAEMLSAIVREEPGRLRGKVLFLFQPAEEGPGGAAPMIAEGVLDEPKVDVCL
GAHVWPSLPVGTVGVKPGPLMAAMDRFELAVHGRGGHAATPHLCVDALETATQVVGALQR
VVSRMTDPLEPVILTIGELHAGTAYNVIPGEARMAGTVRTFSPDVRAAWEDRIRTVADGV
CAAMGATATLDFHYCHGPVINTPRVAEVVRRAVVEARGEQAVTTPTPTLGGEDFSCFLER
IPGCFFFVGCGGDVPIHNPRFDLDERCLALGAETFVRAALLFTEGGATGMTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory