SitesBLAST
Comparing 208145 MicrobesOnline__882:208145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4d8uH Crystal structure of d-cysteine desulfhydrase from salmonella typhimurium at 3.3 a in monoclinic space group with 8 subunits in the asymmetric unit (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 8:327/331 of 4d8uH
4d9fA D-cysteine desulfhydrase from salmonella typhimurium complexed with d- cycloserine (dcs) (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d9fA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), G194 (= G194), S195 (= S195), A196 (= A196), T198 (= T198), Y287 (= Y290), T315 (= T318), G316 (= G319), G317 (= G320)
4d9eA D-cysteine desulfhydrase from salmonella typhimurium complexed with l- cycloserine (lcs) (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d9eA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding [5-hydroxy-6-methyl-4-({[(4E)-3-oxo-1,2-oxazolidin-4-ylidene]amino}methyl)pyridin-3-yl]methyl dihydrogen phosphate: N50 (= N49), K51 (= K50), N79 (= N78), G194 (= G194), S195 (= S195), A196 (= A196), T198 (= T198), Y287 (= Y290), T315 (= T318), G316 (= G319), G317 (= G320)
4d9bA Pyridoxamine 5' phosphate (pmp) bound form of salmonella typhimurium d-cysteine desulfhydrase obtained after co-crystallization with d- cycloserine (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d9bA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), N79 (= N78), G194 (= G194), S195 (= S195), A196 (= A196), T198 (= T198), Y287 (= Y290), T315 (= T318), G316 (= G319), G317 (= G320)
4d99A Salmonella typhimurium d-cysteine desulfhydrase with l-ser bound non- covalently at the active site (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d99A
4d97A Salmonella typhimurium d-cysteine desulfhydrase with d-ser bound at active site (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d97A
4d96A D-cysteine desulfhydrase from salmonella typhimurium complexed with 1- amino-1-carboxycyclopropane (acc) (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d96A
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N50 (= N49), K51 (= K50), S78 (= S77), N79 (= N78), H80 (= H79), G194 (= G194), S195 (= S195), A196 (= A196), T198 (= T198), Y287 (= Y290), T315 (= T318), G316 (= G319), G317 (= G320)
4d8wA Salmonella typhimurium d-cysteine desulfhydrase soaked with d-cys shows pyruvate bound 4 a away from active site (see paper)
42% identity, 98% coverage: 2:327/332 of query aligns to 5:324/328 of 4d8wA
1rqxC Crystal structure of acc deaminase complexed with inhibitor (see paper)
40% identity, 100% coverage: 1:332/332 of query aligns to 1:336/338 of 1rqxC
- active site: K51 (= K50), Y268 (= Y264), Y294 (= Y290)
- binding 1-aminocyclopropylphosphonate: K51 (= K50), S78 (= S77), N79 (= N78), Q80 (≠ H79), T199 (≠ S195), Y294 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), S197 (= S193), V198 (≠ G194), T199 (≠ S195), G200 (≠ A196), T202 (= T198), Y294 (= Y290), E295 (≠ S291), L322 (≠ T318), G323 (= G319), G324 (= G320)
1tzmA Crystal structure of acc deaminase complexed with substrate analog b- chloro-d-alanine (see paper)
40% identity, 100% coverage: 1:332/332 of query aligns to 1:329/331 of 1tzmA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding 3-chloro-D-alanine: G74 (= G73), S78 (= S77), N79 (= N78), Q80 (≠ H79), W102 (≠ R101), A153 (≠ G157), G154 (= G158), Y287 (= Y290)
- binding amino-acrylate: K51 (= K50), S78 (= S77), Q80 (≠ H79), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C189 (≠ P192), S190 (= S193), V191 (≠ G194), T192 (≠ S195), G193 (≠ A196), T195 (= T198), Y287 (= Y290), E288 (≠ S291), L315 (≠ T318), G316 (= G319), G317 (= G320)
1tzkA Crystal structure of 1-aminocyclopropane-1-carboxylate-deaminase complexed with alpha-keto-butyrate (see paper)
40% identity, 100% coverage: 1:332/332 of query aligns to 1:329/331 of 1tzkA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding 2-ketobutyric acid: K51 (= K50), G74 (= G73), S78 (= S77), N79 (= N78), Q80 (≠ H79), A153 (≠ G157), G154 (= G158), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C189 (≠ P192), S190 (= S193), V191 (≠ G194), T192 (≠ S195), G193 (≠ A196), T195 (= T198), Y287 (= Y290), E288 (≠ S291), L315 (≠ T318), G316 (= G319), G317 (= G320)
1tzjA Crystal structure of 1-aminocyclopropane-1-carboxylate deaminase complexed with d-vinyl glycine (see paper)
40% identity, 100% coverage: 1:332/332 of query aligns to 1:329/331 of 1tzjA
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding d-vinylglycine: G74 (= G73), S78 (= S77), N79 (= N78), Q80 (≠ H79), A153 (≠ G157), G154 (= G158), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C189 (≠ P192), S190 (= S193), V191 (≠ G194), T192 (≠ S195), G193 (≠ A196), T195 (= T198), Y287 (= Y290), E288 (≠ S291), L315 (≠ T318), G316 (= G319), G317 (= G320)
1tz2A Crystal structure of 1-aminocyclopropane-1-carboyxlate deaminase complexed with acc (see paper)
40% identity, 100% coverage: 1:332/332 of query aligns to 1:329/331 of 1tz2A
- active site: K51 (= K50), Y261 (= Y264), Y287 (= Y290)
- binding 1-aminocyclopropanecarboxylic acid: K51 (= K50), S78 (= S77), Y287 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C189 (≠ P192), S190 (= S193), V191 (≠ G194), T192 (≠ S195), G193 (≠ A196), T195 (= T198), Y287 (= Y290), E288 (≠ S291), L315 (≠ T318), G316 (= G319), G317 (= G320)
Q5PWZ8 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see paper)
37% identity, 100% coverage: 1:332/332 of query aligns to 1:336/338 of Q5PWZ8
- G44 (= G44) mutation to D: Loss of activity.
1j0bA Crystal structure analysis of the acc deaminase homologue complexed with inhibitor (see paper)
40% identity, 99% coverage: 3:331/332 of query aligns to 9:321/325 of 1j0bA
- active site: K54 (= K50), Y256 (= Y264), Y282 (= Y290)
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: N53 (= N49), K54 (= K50), S81 (= S77), N82 (= N78), H83 (= H79), A189 (≠ S193), G190 (= G194), S191 (= S195), G192 (≠ A196), G193 (= G197), T194 (= T198), Y282 (= Y290), T308 (= T318), G309 (= G319), G310 (= G320)
1j0aA Crystal structure analysis of the acc deaminase homologue (see paper)
40% identity, 99% coverage: 3:331/332 of query aligns to 9:321/325 of 1j0aA
- active site: K54 (= K50), Y256 (= Y264), Y282 (= Y290)
- binding pyridoxal-5'-phosphate: N53 (= N49), K54 (= K50), K57 (= K53), N82 (= N78), G190 (= G194), S191 (= S195), G192 (≠ A196), G193 (= G197), T194 (= T198), Y282 (= Y290), T308 (= T318), G309 (= G319), G310 (= G320)
1f2dA 1-aminocyclopropane-1-carboxylate deaminase (see paper)
36% identity, 99% coverage: 3:331/332 of query aligns to 3:336/341 of 1f2dA
- active site: K51 (= K50), Y269 (= Y264), Y295 (= Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C200 (≠ S193), T202 (≠ S195), G203 (≠ A196), S204 (≠ G197), T205 (= T198), Y295 (= Y290), E296 (≠ S291), L323 (≠ T318), G324 (= G319), G325 (= G320)
Q7M523 1-aminocyclopropane-1-carboxylate deaminase; ACC deaminase; ACCD; EC 3.5.99.7 from Cyberlindnera saturnus (Yeast) (Williopsis saturnus) (see paper)
36% identity, 99% coverage: 3:331/332 of query aligns to 3:336/341 of Q7M523
Sites not aligning to the query:
- 1 modified: N-acetylserine
1j0eA Acc deaminase mutant reacton intermediate (see paper)
36% identity, 99% coverage: 3:331/332 of query aligns to 3:336/341 of 1j0eA
- binding 1-aminocyclopropanecarboxylic acid: S78 (= S77), N79 (= N78), Q80 (≠ H79), F295 (≠ Y290)
- binding pyridoxal-5'-phosphate: N50 (= N49), K51 (= K50), K54 (= K53), N79 (= N78), C199 (≠ P192), T202 (≠ S195), G203 (≠ A196), T205 (= T198), F295 (≠ Y290), E296 (≠ S291)
1j0dA Acc deaminase mutant complexed with acc (see paper)
36% identity, 99% coverage: 3:331/332 of query aligns to 3:336/341 of 1j0dA
- binding n-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-y-lmethyl]-1-amino-cyclopropanecarboxylic acid: S78 (= S77), N79 (= N78), Q80 (≠ H79), A163 (≠ G157), G164 (= G158), C200 (≠ S193), V201 (≠ G194), T202 (≠ S195), G203 (≠ A196), S204 (≠ G197), T205 (= T198), Y295 (= Y290), E296 (≠ S291)
Query Sequence
>208145 MicrobesOnline__882:208145
MNLAVFPRRGYVKDPTPIESCPAFSKALGGKVNIFIKRDDLLPGCAGGNKTRKLDFCMAD
ALAKGADTIITCGAVQSNHCRLTLSWAVKEGLDCHLVLEERVKGSYKPEASGNNFLFKLM
GVKSITVVPGGSNMMGEMEALAARLKEAGRTPYIIPGGASNPIGATGYVSCAQETLQQLF
DMGLKVDHMVVPSGSAGTHAGIVVGMVGNNANIPVSGINVSRTKADQEALVRKLARETAQ
RVGMSGEFPDEAVTCFDGYVGPGYSLPTESMVEAVRLLAQTEGILLDPVYSGKAMAGLVD
LVRSGYFAEGSNVLFLHTGGSPALYAYLDTFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory