Comparing 208146 MicrobesOnline__882:208146 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
53% identity, 98% coverage: 4:129/129 of query aligns to 6:130/137 of P80601
Sites not aligning to the query:
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
52% identity, 96% coverage: 4:127/129 of query aligns to 64:187/187 of Q94JQ4
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
50% identity, 95% coverage: 2:124/129 of query aligns to 1:124/127 of 5v4dA
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
50% identity, 98% coverage: 4:129/129 of query aligns to 1:126/126 of 2b33B
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
50% identity, 97% coverage: 4:128/129 of query aligns to 1:124/124 of 3k0tC
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
48% identity, 93% coverage: 5:124/129 of query aligns to 2:120/124 of 7cd4A
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
50% identity, 98% coverage: 4:129/129 of query aligns to 6:130/137 of P52759
Sites not aligning to the query:
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
49% identity, 93% coverage: 5:124/129 of query aligns to 3:124/128 of Q7CP78
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
40% identity, 99% coverage: 1:128/129 of query aligns to 1:128/128 of A0A1J1DL12
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
50% identity, 84% coverage: 20:127/129 of query aligns to 1:108/108 of 5hp8A
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
46% identity, 93% coverage: 5:124/129 of query aligns to 2:124/127 of 3vczB
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
44% identity, 94% coverage: 4:124/129 of query aligns to 1:123/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
44% identity, 94% coverage: 4:124/129 of query aligns to 1:123/127 of 2uykC
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
30% identity, 86% coverage: 14:124/129 of query aligns to 13:123/128 of P0AFQ5
>208146 MicrobesOnline__882:208146
MTAKKSISTTKAPAAIGPYSQAISAQGLLFVSGQLPIDPATGTLIKDDIEAAAHQVFTNL
RAIAEAAGITLDHAVKTTVFMADLADFKAVNAVYAQYFATPFPARSAIQVAALPLGGTIE
VEAIFALEG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory