Comparing 208247 MicrobesOnline__882:208247 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 98% coverage: 2:252/255 of query aligns to 1:236/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 99% coverage: 2:253/255 of query aligns to 1:237/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 99% coverage: 2:253/255 of query aligns to 1:237/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 99% coverage: 2:253/255 of query aligns to 2:238/241 of 6mbnA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 98% coverage: 2:251/255 of query aligns to 1:235/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 98% coverage: 2:250/255 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 98% coverage: 2:250/255 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
31% identity, 97% coverage: 2:249/255 of query aligns to 1:233/233 of 6b8bA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 99% coverage: 1:252/255 of query aligns to 2:254/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 98% coverage: 1:251/255 of query aligns to 2:253/253 of 1g9xB
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 95% coverage: 3:243/255 of query aligns to 2:227/241 of 4u00A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 97% coverage: 1:248/255 of query aligns to 1:237/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 97% coverage: 1:248/255 of query aligns to 1:237/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 97% coverage: 1:248/255 of query aligns to 1:237/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 97% coverage: 1:248/255 of query aligns to 1:237/353 of Q97UY8
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 95% coverage: 1:243/255 of query aligns to 1:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 95% coverage: 1:243/255 of query aligns to 1:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 95% coverage: 1:243/255 of query aligns to 1:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 95% coverage: 1:243/255 of query aligns to 1:229/242 of 2oljA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
28% identity, 94% coverage: 2:240/255 of query aligns to 3:229/263 of 7d0aB
>208247 MicrobesOnline__882:208247
MALLEIKGLTQRFGGLQAVSDFNIELEAGELAGLIGPNGAGKTTVFNLTSGFYTPTEGSI
TFDGTPTRGLRPHQVTALGIARTFQNIRLWHDLSVLDNIRIAQHHRLGYTLWDAFLRTRR
YTAGEKAIDAIAWEMLEAMDLKEYANEVPRNLPYGMQRRVEIARAMSMKPKLLLLDEPAA
GLNSVDVDGLIRLIRWIHDEFDITIWMIEHQMKVVMSLCQRIKVIDFGSTIADGTPETIQ
TNPVVIKAYLGDDTI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory