Comparing 208250 MicrobesOnline__882:208250 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
35% identity, 94% coverage: 23:385/385 of query aligns to 1:347/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
32% identity, 94% coverage: 23:385/385 of query aligns to 2:348/348 of 4gnrA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
32% identity, 65% coverage: 24:275/385 of query aligns to 3:247/345 of 4n0qB
Sites not aligning to the query:
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4otzA
Sites not aligning to the query:
4og2A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with leucine
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4og2A
Sites not aligning to the query:
4oatA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with isoleucine.
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4oatA
Sites not aligning to the query:
4nv3A The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4nv3A
Sites not aligning to the query:
4nqrA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with alanine
27% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4nqrA
Sites not aligning to the query:
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
26% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4rv5A
Sites not aligning to the query:
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
26% identity, 80% coverage: 22:328/385 of query aligns to 1:305/364 of 4obbA
Sites not aligning to the query:
1uskA L-leucine-binding protein with leucine bound (see paper)
29% identity, 66% coverage: 22:275/385 of query aligns to 1:247/345 of 1uskA
Sites not aligning to the query:
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
29% identity, 66% coverage: 22:275/385 of query aligns to 1:247/345 of 1usiA
Sites not aligning to the query:
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
25% identity, 88% coverage: 24:361/385 of query aligns to 3:323/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
25% identity, 88% coverage: 24:361/385 of query aligns to 3:323/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
25% identity, 88% coverage: 24:361/385 of query aligns to 3:323/344 of 1z16A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
27% identity, 88% coverage: 24:362/385 of query aligns to 3:325/348 of 3ipcA
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
27% identity, 88% coverage: 24:362/385 of query aligns to 3:325/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
27% identity, 88% coverage: 24:362/385 of query aligns to 3:325/348 of 3ip7A
Sites not aligning to the query:
>208250 MicrobesOnline__882:208250
MRKTVLSMLMLLLMASAAYAADTIKIGFDIPLTGDIPKVGEASKFAAEMLRDEINAKGGL
EVGGKKYMLEFVYEDNESKPESAVNAALKLIERDQVLAIVGPNSSKQAVPAGGVADDNET
PLISPWSTNPDTTKGRPWVFRAAFLDPFQAPVVVNFASKQFGAKTAAVMFDVSNDYSKGL
ADIFRVKWEEKHGKGTVVAFESHGTKDQDFSAQLTKLLAAKPDFIFLPENYNIVALIVKQ
AHDLGWKGPFMGSDAWGSAELMTLCGKDCVGQFFSTHYAAAGATGATKEFIDKYTNRYGY
IPDDVAALTWDATRIVLTAIQNGGKVEKDVRKMRKLIRDNISAITTFDGITGKMKFDAEG
DPIKCAVVVKISDKGEFVFTESVCP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory