Comparing 208331 MicrobesOnline__882:208331 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
33% identity, 80% coverage: 28:297/336 of query aligns to 2:268/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
33% identity, 80% coverage: 28:297/336 of query aligns to 1:267/303 of 4p9kA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
30% identity, 80% coverage: 30:297/336 of query aligns to 1:265/301 of 4pdhA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
26% identity, 91% coverage: 30:335/336 of query aligns to 1:300/301 of 4nq8B
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
30% identity, 91% coverage: 31:335/336 of query aligns to 4:304/304 of 4x8rA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
29% identity, 82% coverage: 58:334/336 of query aligns to 28:300/300 of 4n8yA
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
27% identity, 89% coverage: 33:331/336 of query aligns to 8:303/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
27% identity, 89% coverage: 33:331/336 of query aligns to 7:302/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
27% identity, 89% coverage: 33:331/336 of query aligns to 7:302/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
27% identity, 89% coverage: 33:331/336 of query aligns to 7:302/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
27% identity, 89% coverage: 33:331/336 of query aligns to 7:302/310 of 7bcnA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
30% identity, 84% coverage: 48:328/336 of query aligns to 20:304/314 of 4p8bA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
29% identity, 85% coverage: 47:332/336 of query aligns to 18:298/303 of 4pddA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
29% identity, 78% coverage: 33:293/336 of query aligns to 4:256/304 of 4xeqB
Q128M1 Solute-binding protein Bpro_3107 from Polaromonas sp. (strain JS666 / ATCC BAA-500) (see paper)
30% identity, 84% coverage: 54:335/336 of query aligns to 55:330/330 of Q128M1
Sites not aligning to the query:
4mhfA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21 (see paper)
30% identity, 84% coverage: 54:335/336 of query aligns to 25:300/301 of 4mhfA
Sites not aligning to the query:
4mijA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21 (see paper)
30% identity, 84% coverage: 54:335/336 of query aligns to 25:300/302 of 4mijA
Sites not aligning to the query:
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
31% identity, 89% coverage: 1:299/336 of query aligns to 1:287/325 of Q16BC9
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
28% identity, 79% coverage: 59:322/336 of query aligns to 29:285/298 of 4ovrA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
27% identity, 89% coverage: 37:335/336 of query aligns to 9:302/303 of 4p3lA
Sites not aligning to the query:
>208331 MicrobesOnline__882:208331
MRNFFKANAIAAIACIAMLAAGSYAEAAKRITIRLAHPMAPGNNVTLGYEKFKEIVEAKS
NGKVRIQLFGNCMLGSDRVTMEATQRGTLEMASSSSPNMTNFSKEMMVFDLPYITSPEHQ
EKLYKALDEGALGERLDAIAAGIGLKPIMYSEYGYRNFATTKKPIKTADDLKNLKVRTTD
SPIEVAVASALGMNPTPVSWGETYTALQQGTVDGEGNTFGLLNDAKHTEVLRHAMDSAHN
YSMHLLMINKAYFDKLPADVQQILVDSGKEALAYQRAISNDLEKKAEQAFVERGIVITKL
APEERAKMRELTRPVWDKFSNDIPADLVKLVQETQQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory