SitesBLAST
Comparing 208394 MicrobesOnline__882:208394 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yvmA Crystal structure of the archaeal halo-thermophilic red sea brine pool alcohol dehydrogenase adh/d1 bound to nzq (see paper)
33% identity, 98% coverage: 2:392/397 of query aligns to 4:403/403 of 5yvmA
- binding manganese (ii) ion: D207 (= D199), H211 (= H203), H276 (= H268), H291 (= H283)
- binding 5,6-dihydroxy-nadp: G41 (≠ A38), N44 (≠ S41), M45 (= M42), P73 (= P70), N74 (= N71), G100 (= G97), G101 (= G98), S102 (= S99), D105 (= D102), S151 (≠ T143), T152 (= T144), T155 (= T147), T160 (≠ D152), Y162 (≠ W154), V164 (= V156), K173 (= K165), E195 (≠ T187), L200 (≠ I192), H211 (= H203), H276 (= H268), H280 (= H272), H291 (= H283)
5yvrA Crystal structure of the h277a mutant of adh/d1, an archaeal halo- thermophilic red sea brine pool alcohol dehydrogenase (see paper)
33% identity, 98% coverage: 2:392/397 of query aligns to 4:403/403 of 5yvrA
- binding manganese (ii) ion: D207 (= D199), H211 (= H203), H276 (= H268), H291 (= H283)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G41 (≠ A38), S43 (≠ G40), N44 (≠ S41), M45 (= M42), G100 (= G97), G101 (= G98), S102 (= S99), D105 (= D102), S151 (≠ T143), T152 (= T144), T155 (= T147), T160 (≠ D152), Y162 (≠ W154), V164 (= V156), K173 (= K165), E195 (≠ T187), M196 (≠ V188), L200 (≠ I192), D207 (= D199), H211 (= H203), H291 (= H283)
3bfjA Crystal structure analysis of 1,3-propanediol oxidoreductase (see paper)
34% identity, 98% coverage: 4:392/397 of query aligns to 3:382/382 of 3bfjA
P0DJA2 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADH II; EC 1.1.1.1 from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) (see 2 papers)
33% identity, 99% coverage: 1:392/397 of query aligns to 1:383/383 of P0DJA2
- M1 (= M1) modified: Initiator methionine, Removed
- D39 (≠ G39) binding
- N71 (= N71) binding
- G98 (= G98) binding
- S99 (= S99) binding
- T138 (= T143) binding
- T139 (= T144) binding
- T147 (≠ D152) binding
- F149 (≠ W154) binding
- K160 (= K165) binding
- L179 (= L184) binding
- G182 (≠ T187) binding
- M183 (≠ V188) binding
- D194 (= D199) binding
- H198 (= H203) binding
- H263 (= H268) binding
- H267 (= H272) binding
- H277 (= H283) binding ; binding
3ox4A Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 complexed with NAD cofactor (see paper)
33% identity, 98% coverage: 5:392/397 of query aligns to 4:382/382 of 3ox4A
- binding fe (ii) ion: D193 (= D199), H197 (= H203), H262 (= H268), H276 (= H283)
- binding nicotinamide-adenine-dinucleotide: D38 (≠ G39), F40 (≠ S41), M41 (= M42), N70 (= N71), G96 (= G97), G97 (= G98), S98 (= S99), T137 (= T143), T138 (= T144), F148 (≠ W154), I150 (≠ V156), G181 (≠ T187), M182 (≠ V188), L186 (≠ I192), H276 (= H283)
3owoA Structures of iron-dependent alcohol dehydrogenase 2 from zymomonas mobilis zm4 with and without NAD cofactor (see paper)
33% identity, 98% coverage: 5:392/397 of query aligns to 4:382/382 of 3owoA
P31005 NAD-dependent methanol dehydrogenase; MDH; MEDH; Type 3 alcohol dehydrogenase; EC 1.1.1.244 from Bacillus methanolicus (see 3 papers)
33% identity, 91% coverage: 5:366/397 of query aligns to 3:357/381 of P31005
- G13 (= G15) mutation to A: Shows a reduced dehydrogenase activity.
- G15 (= G17) mutation to A: Shows almost the same dehydrogenase activity as the wild-type.
- D88 (= D90) mutation to N: Shows almost the same dehydrogenase activity as the wild-type.
- G95 (= G97) mutation to A: Shows a 10-fold decreased affinity for NAD and NADH and a strongly reduced dehydrogenase activity. Completely insensitive to the stimulating effect of the activator protein Act.
- S97 (= S99) mutation to G: Shows an increase of the dehydrogenase activity and a decrease of the affinity for NAD and NADH. Completely insensitive to the stimulating effect of the activator protein Act. It does not bind NAD.; mutation to T: Shows an increase of the dehydrogenase activity and affinity for NAD and NADH.
- D100 (= D102) mutation to N: Loss of dehydrogenase activity. It still binds NADH.
- K103 (= K105) mutation to R: Loss of dehydrogenase activity. It does not bind NADH.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7w9yA Crystal structure of bacillus subtilis yugj in complex with NADP and nickel (see paper)
30% identity, 99% coverage: 1:392/397 of query aligns to 3:389/389 of 7w9yA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G40 (≠ A38), G41 (= G39), S43 (= S41), P72 (= P70), N73 (= N71), G99 (= G97), G100 (= G98), S101 (= S99), T140 (= T143), L141 (≠ T144), T144 (= T147), K162 (= K165), T184 (= T187), V185 (= V188), P186 (= P189), H189 (≠ I192), H283 (= H283)
7w9zA Crystal structure of bacillus subtilis yugj in complex with NADP and nitrate (see paper)
30% identity, 98% coverage: 3:392/397 of query aligns to 2:381/381 of 7w9zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G37 (≠ A38), G38 (= G39), S40 (= S41), P69 (= P70), G96 (= G97), G97 (= G98), S98 (= S99), D101 (= D102), T137 (= T143), L138 (≠ T144), T141 (= T147), N146 (≠ D152), G148 (≠ W154), K159 (= K165), T181 (= T187), V182 (= V188), P183 (= P189), H186 (≠ I192)
- binding nitrate ion: R72 (≠ S73), V73 (≠ L74), S74 (≠ V75), V150 (= V156), N153 (≠ R159), W154 (≠ D160), E155 (= E161), W263 (≠ I265), H270 (= H272), H280 (= H283)
1vhdA Crystal structure of an iron containing alcohol dehydrogenase (see paper)
32% identity, 98% coverage: 4:392/397 of query aligns to 3:358/361 of 1vhdA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S39 (≠ G39), S40 (≠ G40), E69 (≠ P70), N70 (= N71), G96 (= G97), G97 (= G98), S98 (= S99), D101 (= D102), T137 (= T143), T138 (= T144), T141 (= T147), S143 (≠ T149), T146 (≠ D152), Y148 (≠ W154), I150 (≠ V156), K158 (≠ E164), S178 (≠ T187), M179 (≠ V188), L183 (≠ I192), D190 (= D199), H194 (= H203), H271 (= H283)
- binding zinc ion: D190 (= D199), H194 (= H203), H257 (= H268), H271 (= H283)
1o2dA Crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution (see paper)
32% identity, 98% coverage: 4:392/397 of query aligns to 2:357/359 of 1o2dA
- binding fe (iii) ion: D189 (= D199), H193 (= H203), H256 (= H268), H270 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S38 (≠ G39), S39 (≠ G40), E68 (≠ P70), N69 (= N71), G95 (= G97), G96 (= G98), S97 (= S99), D100 (= D102), T136 (= T143), T137 (= T144), T140 (= T147), S142 (≠ T149), Y147 (≠ W154), I149 (≠ V156), K157 (≠ E164), S177 (≠ T187), M178 (≠ V188), L182 (≠ I192), D189 (= D199), H193 (= H203), H270 (= H283)
1vljB Crystal structure of nadh-dependent butanol dehydrogenase a (tm0820) from thermotoga maritima at 1.78 a resolution
30% identity, 91% coverage: 1:363/397 of query aligns to 6:364/400 of 1vljB
- binding fe (iii) ion: D200 (= D199), H204 (= H203), H273 (= H268), H287 (= H283)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G45 (= G39), S47 (= S41), P76 (= P70), G103 (= G97), G104 (= G98), S105 (= S99), D108 (= D102), T144 (= T143), I145 (≠ T144), T148 (= T147), T150 (= T149), N153 (≠ D152), N155 (≠ W154), K166 (= K165), T188 (= T187), L189 (≠ V188), Q193 (≠ I192), H204 (= H203), H287 (= H283)
3zdrA Structure of the alcohol dehydrogenase (adh) domain of a bifunctional adhe dehydrogenase from geobacillus thermoglucosidasius ncimb 11955 (see paper)
33% identity, 78% coverage: 6:316/397 of query aligns to 5:325/403 of 3zdrA
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
32% identity, 86% coverage: 9:349/397 of query aligns to 9:343/376 of 6jkpA
- binding nicotinamide-adenine-dinucleotide: F42 (≠ V35), G96 (= G98), D100 (= D102), T137 (= T143), T138 (= T144), T141 (= T147), S143 (≠ T149), T146 (≠ D152), S181 (≠ T187), V182 (= V188), P183 (= P189)
6jkoA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense (see paper)
32% identity, 86% coverage: 9:349/397 of query aligns to 9:343/376 of 6jkoA
8i29A Crystal structure of butanol dehydrogenase a (yqdh) in complex with nadh from fusobacterium nucleatum
25% identity, 95% coverage: 3:379/397 of query aligns to 2:376/384 of 8i29A
- binding cobalt (ii) ion: E205 (= E206), H271 (= H268), H285 (= H283)
- binding nicotinamide-adenine-dinucleotide: A102 (≠ G98), T142 (= T143), I143 (≠ T144), A146 (≠ T147), S148 (≠ T149), S151 (≠ D152), S153 (≠ W154), I155 (≠ V156), T186 (= T187), I187 (≠ V188), L191 (≠ I192)
7fjgA Crystal structure of butanol dehydrogenase a (yqdh) in complex with partial nadh from fusobacterium nucleatum
25% identity, 95% coverage: 3:379/397 of query aligns to 2:376/384 of 7fjgA
6scgA Structure of adhe form 1 (see paper)
31% identity, 84% coverage: 3:334/397 of query aligns to 1:343/406 of 6scgA
- binding fe (iii) ion: D204 (= D199), H208 (= H203), H274 (= H268), H288 (= H283)
- binding nicotinamide-adenine-dinucleotide: D38 (≠ G39), F40 (≠ S41), A69 (≠ P70), D70 (≠ N71), G96 (= G97), G97 (= G98), S98 (= S99), T148 (= T143), T149 (= T144), T152 (= T147), V161 (= V156), L197 (≠ I192), H278 (= H272)
Q46856 Alcohol dehydrogenase YqhD; EC 1.1.1.2 from Escherichia coli (strain K12) (see paper)
29% identity, 92% coverage: 1:366/397 of query aligns to 1:362/387 of Q46856
- GGS 38:40 (= GGS 39:41) binding
- 93:99 (vs. 96:102, 71% identical) binding
- T138 (= T143) binding
- N147 (≠ D152) binding
- K160 (= K165) binding
- YTYT 179:182 (≠ LTIT 184:187) binding
- D194 (= D199) binding
- H198 (= H203) binding
- H267 (= H268) binding
- H281 (= H283) binding
1oj7B Structural genomics, unknown function crystal structure of e. Coli k-12 yqhd (see paper)
29% identity, 92% coverage: 3:366/397 of query aligns to 6:365/390 of 1oj7B
- binding 5,6-dihydroxy-nadp: G41 (= G39), S43 (= S41), P70 (= P70), N71 (= N71), G97 (= G97), G98 (= G98), S99 (= S99), D102 (= D102), T141 (= T143), L142 (≠ T144), T145 (= T147), S147 (≠ T149), G152 (≠ W154), V154 (= V156), K163 (= K165), T185 (= T187), L186 (≠ V188), P187 (= P189), Q190 (≠ I192), H201 (= H203), H270 (= H268), H284 (= H283)
- binding zinc ion: D197 (= D199), H201 (= H203), H270 (= H268), H284 (= H283)
Query Sequence
>208394 MicrobesOnline__882:208394
MLDFTFHVPTRIVFGAGRLEELGRLPLPGVKPLVVVGAGGSMRRHGHLDRVLALLRQNGC
EPMLFERVRPNPSLVHVDEGACVARANGCDFIVGLGGGSPIDAAKAIALAAANGGSYWDY
IQSGTGGRRTPQHPALPVVAIPTTAGTGTEADPWTVVTRDETQEKIGWGNDSTYPVLSIV
DPALTITVPPRITAMTGMDAFFHAVEAYLSLSRQPSSDLLALEAVSLLAQFLPQAVRQGD
SVEVRSMVSWASTAAGLCESLSSCIAHHSMEHALSAYHPDLPHGAGLVMLSLPFFEVMAR
VQPKRCADLAATMGMPLHGLPPAQQGMAFVEGLRLLIRAVGLDDLRLADHGITAAEIPAL
AKNARETMGALFPLTPVDLRPEDVEAIFAKALAGPTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory