Comparing 208732 MicrobesOnline__882:208732 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2c2bA Crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine (see paper)
34% identity, 86% coverage: 19:434/482 of query aligns to 16:416/444 of 2c2bA
Q9S7B5 Threonine synthase 1, chloroplastic; Protein METHIONINE OVER-ACCUMULATOR 2; EC 4.2.3.1 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 86% coverage: 19:434/482 of query aligns to 91:491/526 of Q9S7B5
2c2gA Crystal structure of threonine synthase from arabidopsis thaliana in complex with its cofactor pyridoxal phosphate (see paper)
33% identity, 86% coverage: 19:434/482 of query aligns to 34:418/448 of 2c2gA
2zsjA Crystal structure of threonine synthase from aquifex aeolicus vf5
35% identity, 72% coverage: 75:420/482 of query aligns to 3:322/350 of 2zsjA
6nmxA Threonine synthase from bacillus subtilis atcc 6633 with plp and appa (see paper)
33% identity, 72% coverage: 73:420/482 of query aligns to 2:320/350 of 6nmxA
2d1fA Structure of mycobacterium tuberculosis threonine synthase (see paper)
34% identity, 73% coverage: 76:427/482 of query aligns to 5:331/349 of 2d1fA
P9WG59 Threonine synthase; TS; EC 4.2.3.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 73% coverage: 76:427/482 of query aligns to 14:340/360 of P9WG59
6cgqB Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
33% identity, 72% coverage: 75:420/482 of query aligns to 2:318/345 of 6cgqB
A0R220 Threonine synthase; TS; EC 4.2.3.1 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
34% identity, 72% coverage: 76:420/482 of query aligns to 14:331/360 of A0R220
3aeyA Apo form of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 71% coverage: 77:420/482 of query aligns to 5:321/350 of 3aeyA
1uimA Crystal structure of threonine synthase from thermus thermophilus hb8, orthorhombic crystal form (see paper)
36% identity, 71% coverage: 77:420/482 of query aligns to 6:322/350 of 1uimA
3aexA Catalytic intermediate analogue of threonine synthase from thermus thermophilus hb8 (see paper)
36% identity, 71% coverage: 77:420/482 of query aligns to 6:322/351 of 3aexA
1v7cA Crystal structure of threonine synthase from thermus thermophilus hb8 in complex with a substrate analogue (see paper)
36% identity, 71% coverage: 77:420/482 of query aligns to 6:322/351 of 1v7cA
6cgqA Threonine synthase from bacillus subtilis atcc 6633 with plp and plp- ala (see paper)
33% identity, 72% coverage: 76:420/482 of query aligns to 1:310/339 of 6cgqA
1vb3A Crystal structure of threonine synthase from escherichia coli
31% identity, 46% coverage: 127:350/482 of query aligns to 102:318/428 of 1vb3A
4f4fA X-ray crystal structure of plp bound threonine synthase from brucella melitensis
30% identity, 31% coverage: 127:275/482 of query aligns to 108:263/464 of 4f4fA
Sites not aligning to the query:
1kl7A Crystal structure of threonine synthase from yeast (see paper)
24% identity, 31% coverage: 127:275/482 of query aligns to 118:281/509 of 1kl7A
Sites not aligning to the query:
8g1yA Crystal structure of the threonine synthase from streptococcus pneumoniae in complex with pyridoxal 5-phosphate.
29% identity, 31% coverage: 128:275/482 of query aligns to 110:276/496 of 8g1yA
Sites not aligning to the query:
Q42598 Threonine synthase; TS; EC 4.2.3.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 31% coverage: 127:275/482 of query aligns to 112:277/514 of Q42598
Sites not aligning to the query:
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
30% identity, 26% coverage: 100:226/482 of query aligns to 10:126/327 of Q8VBT2
Sites not aligning to the query:
>208732 MicrobesOnline__882:208732
MPSCDFPGWRSRMEYVCLGCGARHSIDELLYTCPSCGGVFLLEDLDFDHLADHRSGDDWR
TLFDSRASTRCRSLRGIFRFYELMAPVLEEDDIIYLGEGNTPVVDASPALERSVGQRFAY
KNDGQNPSASFKDRGMACAFSYLRALVRKHGWDEVLTICASTGDTSAAAALYASYVGSPI
KSAVILPHGKVTPQQLSQPLGSGATVLEIPGVFDDCMKVVEHLAENYRVALLNSKNSWRI
LGQESYAFEVAQWYGWDMAGKCVFVPIGNAGNITAVMSGFLKMHRLGIIDALPRVFGVQS
HHADPVYRYYSVEDPRQRHYEPVTVQPSVAQAAMIGNPVSFPRVRHLAERFEALGGPGAF
QVVQVTEQAIMDSMIRANRHGHIACTQGGECLAGLLRAKELGLVDKDETAVLDATAHSLK
FSGFQDMYFTNGFPPAYGVTPDATLGNAPSLVLHDEDKVALAEKYTVEAAQRIAAKLGLA
GK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory