SitesBLAST
Comparing 208777 MicrobesOnline__882:208777 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
4r1lA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.42 a resolution
27% identity, 94% coverage: 15:408/421 of query aligns to 12:420/433 of 4r1lA
- binding adenosine-5'-diphosphate: A215 (≠ G217), E216 (= E218), P217 (≠ R219), S237 (≠ G239), F238 (≠ Y240), G239 (= G241), M240 (≠ T242), T241 (≠ A243), D305 (= D303), R329 (= R327), N340 (≠ F338)
- binding adenosine monophosphate: A215 (≠ G217), E216 (= E218), P217 (≠ R219), S237 (≠ G239), F238 (≠ Y240), G239 (= G241), M240 (≠ T242), T241 (≠ A243), D305 (= D303), R329 (= R327), N340 (≠ F338)
- binding coenzyme a: S136 (≠ T137), A164 (≠ P165), G165 (≠ S166), N166 (≠ D167), S167 (≠ A168), I185 (≠ T186), Y188 (= Y189), K337 (= K335), T408 (≠ R396)
- binding zinc ion: C252 (= C252), H259 (= H259), C314 (= C312), C316 (= C314)
4r1mA Crystal structure of a putative acyl-coa ligase (bt_0428) from bacteroides thetaiotaomicron vpi-5482 at 2.48 a resolution
27% identity, 94% coverage: 15:408/421 of query aligns to 12:420/435 of 4r1mA
- binding adenosine monophosphate: A215 (≠ G217), E216 (= E218), P217 (≠ R219), N236 (≠ Q238), S237 (≠ G239), F238 (≠ Y240), G239 (= G241), M240 (≠ T242), T241 (≠ A243), D305 (= D303), R329 (= R327), I335 (≠ R333), N340 (≠ F338)
- binding zinc ion: C252 (= C252), H259 (= H259), C314 (= C312), C316 (= C314)
2y27B Crystal structure of paak1 in complex with atp from burkholderia cenocepacia (see paper)
29% identity, 86% coverage: 15:375/421 of query aligns to 5:372/427 of 2y27B
- binding adenosine-5'-triphosphate: K65 (= K72), S90 (= S102), S91 (≠ P103), G92 (= G104), T93 (≠ P105), T94 (≠ I106), F138 (≠ A143), A211 (≠ G217), E212 (= E218), P213 (≠ R219), D232 (≠ Q238), I233 (≠ G239), Y234 (= Y240), G235 (= G241), L236 (≠ T242), S237 (≠ A243), D302 (= D303), I320 (= I324), R323 (= R327)
- binding magnesium ion: V200 (≠ R205), S202 (≠ D207), L204 (= L210), M226 (≠ F232), G227 (≠ D233), Q347 (≠ R350), L350 (≠ E353)
Sites not aligning to the query:
2y4nA Paak1 in complex with phenylacetyl adenylate (see paper)
29% identity, 86% coverage: 15:375/421 of query aligns to 5:370/426 of 2y4nA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: Y131 (≠ F138), F136 (≠ A143), G138 (≠ A145), G208 (≠ T216), A209 (≠ G217), E210 (= E218), P211 (≠ R219), I231 (≠ G239), Y232 (= Y240), G233 (= G241), L234 (≠ T242), S235 (≠ A243), P240 (≠ G246), D300 (= D303), R321 (= R327)
- binding magnesium ion: V198 (≠ R205), S200 (≠ D207), Q345 (≠ R350), L348 (≠ E353)
Sites not aligning to the query:
6hdyA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with s3-hb-amp (see paper)
25% identity, 94% coverage: 11:407/421 of query aligns to 26:447/474 of 6hdyA
- binding (3s)-3-hydroxybutanoic acid: Y162 (≠ H141), S237 (≠ T216), G263 (≠ F232), S264 (≠ D233), M265 (= M234), A266 (≠ V235), F271 (≠ Y240)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (3~{S})-3-oxidanylbutanoate: Y162 (≠ H141), G164 (≠ A143), S237 (≠ T216), G238 (= G217), E239 (= E218), P240 (vs. gap), C262 (≠ K231), G263 (≠ F232), S264 (≠ D233), A266 (≠ V235), F271 (≠ Y240), D331 (= D303), I353 (= I324), R356 (= R327)
Sites not aligning to the query:
6hdxA Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in the postadenylation state in complex with r3-hib-amp (see paper)
25% identity, 94% coverage: 11:407/421 of query aligns to 26:447/474 of 6hdxA
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] (2~{R})-2-methyl-3-oxidanyl-propanoate: Y162 (≠ H141), G164 (≠ A143), S237 (≠ T216), G238 (= G217), E239 (= E218), P240 (vs. gap), C262 (≠ K231), G263 (≠ F232), S264 (≠ D233), A266 (≠ V235), F271 (≠ Y240), D331 (= D303), I353 (= I324), R356 (= R327)
- binding (2r)-3-hydroxy-2-methylpropanoic acid: Y162 (≠ H141), G164 (≠ A143), S237 (≠ T216), G263 (≠ F232), S264 (≠ D233), A266 (≠ V235), F271 (≠ Y240)
Sites not aligning to the query:
6he0A Crystal structure of 2-hydroxyisobutyryl-coa ligase (hcl) in complex with 2-hib-amp and coa in the thioesterfication state (see paper)
25% identity, 94% coverage: 11:407/421 of query aligns to 26:451/477 of 6he0A
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] 2-methyl-2-oxidanyl-propanoate: S241 (≠ T216), G242 (= G217), E243 (= E218), P244 (vs. gap), G267 (≠ F232), S268 (≠ D233), M269 (= M234), A270 (≠ V235), D335 (= D303), I357 (= I324), N371 (≠ F338)
- binding adenosine monophosphate: G242 (= G217), E243 (= E218), P244 (vs. gap), C266 (≠ K231), G267 (≠ F232), S268 (≠ D233), A270 (≠ V235), E271 (≠ M236), D335 (= D303), N371 (≠ F338)
- binding coenzyme a: Y166 (≠ H141), A188 (≠ P162), G189 (≠ A163), P191 (= P165), S194 (≠ A168), Y210 (≠ V184), G211 (= G185), T212 (= T186), Y215 (= Y189), H218 (= H192), R368 (≠ K335), G369 (= G336), M401 (≠ I367), V439 (≠ L395), R440 (= R396)
2y4oB Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
26% identity, 94% coverage: 15:408/421 of query aligns to 7:418/432 of 2y4oB
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F138), F140 (≠ A143), G212 (≠ T216), A213 (≠ G217), E214 (= E218), P215 (≠ R219), I235 (≠ G239), G237 (= G241), L238 (≠ T242), S239 (≠ A243), P244 (≠ I248), D304 (= D303), R325 (= R327), I331 (≠ R333), N336 (≠ F338)
- binding magnesium ion: S204 (≠ L208), V228 (≠ F232)
2y4oA Crystal structure of paak2 in complex with phenylacetyl adenylate (see paper)
26% identity, 94% coverage: 15:408/421 of query aligns to 7:418/433 of 2y4oA
- binding 5'-o-[hydroxy(phenylacetyl)phosphoryl]adenosine: F135 (= F138), F140 (≠ A143), A213 (≠ G217), E214 (= E218), P215 (≠ R219), I235 (≠ G239), G237 (= G241), L238 (≠ T242), S239 (≠ A243), P244 (≠ I248), D304 (= D303), R325 (= R327), I331 (≠ R333), N336 (≠ F338)
6siwA Paak family amp-ligase with amp (see paper)
26% identity, 67% coverage: 126:409/421 of query aligns to 112:402/432 of 6siwA
- binding adenosine monophosphate: A208 (≠ G217), E209 (= E218), P210 (≠ R219), E231 (≠ G239), Y232 (= Y240), G233 (= G241), S234 (≠ T242), T235 (≠ A243), D295 (= D303), V315 (≠ I324)
- binding magnesium ion: P116 (= P130), G143 (= G157), T145 (≠ A159), E236 (≠ D244)
- binding zinc ion: C244 (= C252), H250 (≠ L258), C304 (= C312), C306 (= C314)
Sites not aligning to the query:
6sixB Paak family amp-ligase with anp (see paper)
26% identity, 67% coverage: 126:409/421 of query aligns to 117:407/437 of 6sixB
- binding phosphoaminophosphonic acid-adenylate ester: A213 (≠ G217), E214 (= E218), P215 (≠ R219), E236 (≠ G239), Y237 (= Y240), G238 (= G241), S239 (≠ T242), T240 (≠ A243), E241 (≠ D244), D300 (= D303), V320 (≠ I324), R323 (= R327)
- binding magnesium ion: P121 (= P130), T150 (≠ A159)
- binding zinc ion: C249 (= C252), H255 (≠ L258), C309 (= C312), C311 (= C314)
Sites not aligning to the query:
6siyA Paak family amp-ligase with amp and substrate (see paper)
26% identity, 67% coverage: 126:409/421 of query aligns to 113:403/433 of 6siyA
- binding 3-hydroxyanthranilic acid: T125 (≠ F138), P126 (≠ N139), T132 (≠ A145), L135 (≠ M148), R153 (≠ S166), N177 (≠ T186), A209 (≠ G217), E232 (≠ G239), G234 (= G241), S235 (≠ T242)
- binding adenosine monophosphate: A209 (≠ G217), E210 (= E218), P211 (≠ R219), E232 (≠ G239), Y233 (= Y240), G234 (= G241), S235 (≠ T242), T236 (≠ A243), D296 (= D303), V316 (≠ I324)
- binding magnesium ion: P117 (= P130), G144 (= G157), A145 (≠ C158), T146 (≠ A159)
Sites not aligning to the query:
Query Sequence
>208777 MicrobesOnline__882:208777
MTRKDRTEGIYSRREVLDESERRQYYLIQLKDLLAYAYRYSEDVKKRFDRAQFSVEKFKT
LSDLKHIPILKKKELIFLQSMGPRLGGLLTKDLGELKRIFLSPGPIFDPEDRADDYWGYT
EAFYSVGFRPGDLSQITFNYHLAPAGLMFEEPLRNLGCAVVPAGPSDASTQLDIMQKLRV
SGYVGTPSYLMHLAQKAEEKGLNLRKDLFLEVAFVTGERLSEKMRAQLEKKFDMVMRQGY
GTADVGCIGYECFHKTGLHIANRCFVEICHPDTGIPLKDGEVGEIVVTAFNKTYPLIRLA
TGDLSYIDRSPCLCGRTSPRLGSIVGRVDTTARIKGMFVYPHQVEQVMSRFEEVKRWQIE
VTNPGGIDEMTLLIEASNFRREDELLHQFREKIKLRPDLKILTPGTLPPQIRPIEDKRVW
D
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory