Comparing 208788 MicrobesOnline__882:208788 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
E9AE57 Fumarate hydratase 2; Fumarase 2; LmFH-2; EC 4.2.1.2 from Leishmania major (see paper)
31% identity, 90% coverage: 23:274/279 of query aligns to 94:351/568 of E9AE57
Sites not aligning to the query:
6msnA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
31% identity, 90% coverage: 23:274/279 of query aligns to 67:324/532 of 6msnA
Sites not aligning to the query:
6uoiA Crystal structure of cytosolic fumarate hydratase from leishmania major in a complex with malonate (see paper)
31% identity, 90% coverage: 23:274/279 of query aligns to 69:326/535 of 6uoiA
Sites not aligning to the query:
6unzA Crystal structure of cytosolic fumarate hydratase from leishmania major (see paper)
31% identity, 90% coverage: 23:274/279 of query aligns to 74:331/539 of 6unzA
Sites not aligning to the query:
P14407 Fumarate hydratase class I, anaerobic; D-tartrate dehydratase; Fumarase B; EC 4.2.1.2; EC 4.2.1.81 from Escherichia coli (strain K12) (see paper)
29% identity, 95% coverage: 11:274/279 of query aligns to 45:323/548 of P14407
6msoA Crystal structure of mitochondrial fumarate hydratase from leishmania major in a complex with inhibitor thiomalate (see paper)
31% identity, 89% coverage: 28:274/279 of query aligns to 70:324/540 of 6msoA
Sites not aligning to the query:
Q4QAU9 Fumarate hydratase 1, mitochondrial; Fumarase 1; LmFH-1; EC 4.2.1.2 from Leishmania major (see paper)
31% identity, 89% coverage: 28:274/279 of query aligns to 79:333/549 of Q4QAU9
6uqnB Crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate (see paper)
31% identity, 90% coverage: 23:274/279 of query aligns to 67:324/532 of 6uqnB
Sites not aligning to the query:
>208788 MicrobesOnline__882:208788
MRKIPAKDVIEAVARLCTGCNHHLPGDVRAAFERAHAAETDDVPREVFRQLLENADLAAN
SALPLCQDTGLAVFFVEMGEGCRVDGLALREAITEGVRKGYGEGHLRKSSCDPFSRANTG
DNTPAIIHIDLVPGDRLHIAFMAKGGGSENMSRVTMLAPAQGWKGIRDFVVRRVAEAGPN
PCPPVLVGVGVGGTFEYAAMLSKKALLRNVDDVHPDAALAAREAELLDAINALGIGPMGL
GGRTTCLAVKMAVAPCHLASLPLAVNIQCHSARHGEVTL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory