Comparing 208792 MicrobesOnline__882:208792 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6lrgB Crystal structure of the ternary complex of agre with ornithine and NAD+ (see paper)
32% identity, 90% coverage: 22:398/420 of query aligns to 363:677/681 of 6lrgB
Sites not aligning to the query:
6lrgA Crystal structure of the ternary complex of agre with ornithine and NAD+ (see paper)
40% identity, 53% coverage: 175:398/420 of query aligns to 459:671/678 of 6lrgA
Sites not aligning to the query:
6lrhA Crystal structure of the binary complex of agre c264a mutant with l- arginine (see paper)
41% identity, 53% coverage: 175:398/420 of query aligns to 459:669/675 of 6lrhA
Sites not aligning to the query:
>208792 MicrobesOnline__882:208792
MRYTYQHPDFDAPALRAAPLTRFAPGPADGVAPGGYHATSIFPEYLHVEQGRWVLLERSR
MDCVIRQNPDGTLEVVEFRRLKAGDLVALGRGEHAEEGILVHPAGFSASASDEETGPDAT
PRAPTSPPCGRCGDASVPASAVPPGSPASTQEQPFAFRTGISRETSFSIDYDTLYEILRH
DRENGFIVWVAGPAVVFDADARNAFASLVEQGYVHALLAGNALATHDMEGALYGTALGQG
IYHKRQAPMGHYHHLDCINAVREAGGIAAAVRSGLIRDGVMHAVVKYGVPFVLAGSIRDD
GPLPDVIPDVYDAQDAMRQLVSRATTVVALATQLHTIATGNMTPSYQVLEDGGVRPVHFF
VVDMSEFAAGKLADRGSLSARAILTNVQDFVVNVTRALSPSKPLPRTQENACPKGAEPAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory