SitesBLAST
Comparing 208820 MicrobesOnline__882:208820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rjiC Acetolactate synthase from bacillus subtilis bound to thdp - crystal form i (see paper)
34% identity, 97% coverage: 4:532/547 of query aligns to 5:537/555 of 4rjiC
- binding magnesium ion: D438 (= D433), D465 (= D460), T467 (≠ G462)
- binding thiamine diphosphate: P24 (= P23), E48 (= E47), P74 (= P73), S387 (≠ M382), H388 (≠ Y383), Q411 (≠ A406), G437 (= G432), D438 (= D433), G439 (= G434), G440 (= G435), T467 (≠ G462), Y468 (= Y463), D469 (≠ G464), M470 (= M465), V471 (≠ I466), Y534 (= Y529)
4rjkG Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
34% identity, 97% coverage: 4:532/547 of query aligns to 4:536/553 of 4rjkG
- binding magnesium ion: D437 (= D433), D464 (= D460), T466 (≠ G462)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: E47 (= E47), Q110 (= Q110)
- binding thiamine diphosphate: I384 (≠ N380), G385 (= G381), S386 (≠ M382), H387 (≠ Y383), Q410 (≠ A406), L412 (≠ M408), G436 (= G432), D437 (= D433), G438 (= G434), G439 (= G435), T466 (≠ G462), Y467 (= Y463), D468 (≠ G464), M469 (= M465), V470 (≠ I466), Y533 (= Y529)
4rjkF Acetolactate synthase from bacillus subtilis bound to lthdp - crystal form ii (see paper)
34% identity, 97% coverage: 4:532/547 of query aligns to 4:536/552 of 4rjkF
- binding magnesium ion: D437 (= D433), D464 (= D460), T466 (≠ G462)
- binding pyruvic acid: A25 (≠ E25), K26 (≠ E26)
- binding thiamine diphosphate: P23 (= P23), E47 (= E47), P73 (= P73), G385 (= G381), S386 (≠ M382), H387 (≠ Y383), Q410 (≠ A406), L412 (≠ M408), G436 (= G432), D437 (= D433), G438 (= G434), G439 (= G435), T466 (≠ G462), Y467 (= Y463), D468 (≠ G464), M469 (= M465), V470 (≠ I466), Y533 (= Y529)
5d6rB Acetolactate synthase from klebsiella pneumoniae in complex with mechanism-based inhibitor
33% identity, 97% coverage: 4:532/547 of query aligns to 8:538/548 of 5d6rB
- active site: I26 (= I22), G28 (= G24), A29 (≠ E25), K30 (≠ E26), I31 (≠ N27), E51 (= E47), T74 (= T70), H113 (≠ F109), Q114 (= Q110), S115 (≠ I111), Q163 (≠ E159), L254 (= L250), E281 (≠ P277), M386 (≠ N380), Q412 (≠ A406), M414 (= M408), D439 (= D433), D466 (= D460), G468 (= G462), Y469 (= Y463), M471 (= M465), V472 (≠ I466), Q475 (≠ K469), Y535 (= Y529)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(Z)-2-fluoro-1-hydroxy-2-phosphonoethenyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M386 (≠ N380), G387 (= G381), S388 (≠ M382), Q412 (≠ A406), M414 (= M408), D439 (= D433), G440 (= G434), G468 (= G462), Y469 (= Y463), N470 (≠ G464), M471 (= M465), Y535 (= Y529)
- binding magnesium ion: R63 (= R59), Q212 (≠ R209), D439 (= D433), D466 (= D460), G468 (= G462)
1ozgA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactor and with an unusual intermediate (see paper)
33% identity, 97% coverage: 4:532/547 of query aligns to 9:541/549 of 1ozgA
- active site: I27 (= I22), G29 (= G24), A30 (≠ E25), K31 (≠ E26), I32 (≠ N27), E52 (= E47), T75 (= T70), H114 (≠ F109), Q115 (= Q110), S116 (≠ I111), Q164 (≠ E159), L257 (= L250), E284 (≠ P277), M389 (≠ N380), Q415 (≠ A406), M417 (= M408), D442 (= D433), D469 (= D460), G471 (= G462), Y472 (= Y463), M474 (= M465), V475 (≠ I466), Q478 (≠ K469), Y538 (= Y529)
- binding 2-hydroxyethyl dihydrothiachrome diphosphate: M389 (≠ N380), G390 (= G381), S391 (≠ M382), F392 (≠ Y383), Q415 (≠ A406), M417 (= M408), G441 (= G432), D442 (= D433), G443 (= G434), D469 (= D460), G471 (= G462), Y472 (= Y463), N473 (≠ G464), M474 (= M465), V475 (≠ I466), Y538 (= Y529)
- binding magnesium ion: D442 (= D433), D469 (= D460), G471 (= G462)
- binding phosphate ion: G253 (= G246), R254 (≠ T247), Q261 (≠ D254), R347 (≠ K339), R398 (= R389), Y401 (≠ R392)
5dx6B Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
32% identity, 97% coverage: 2:532/547 of query aligns to 18:544/557 of 5dx6B
- active site: I38 (= I22), G40 (= G24), A41 (≠ E25), K42 (≠ E26), I43 (≠ N27), E63 (= E47), T86 (= T70), H125 (≠ F109), Q126 (= Q110), S127 (≠ I111), Q175 (≠ E159), L268 (= L250), E295 (≠ P277), M392 (≠ N380), Q418 (≠ A406), M420 (= M408), D445 (= D433), D472 (= D460), G474 (= G462), Y475 (= Y463), M477 (= M465), V478 (≠ I466), Q481 (≠ K469), Y541 (= Y529)
- binding 3-fluoro-2-oxopropanoic acid: G264 (= G246), R265 (≠ T247), Q272 (≠ D254), A400 (= A388), R401 (= R389), Y404 (≠ R392)
- binding magnesium ion: S135 (≠ E119), T138 (= T122), D445 (= D433), D472 (= D460), G474 (= G462)
- binding thiamine diphosphate: G393 (= G381), S394 (≠ M382), F395 (≠ Y383), Q418 (≠ A406), M420 (= M408), G444 (= G432), D445 (= D433), G446 (= G434), D472 (= D460), G474 (= G462), Y475 (= Y463), N476 (≠ G464), M477 (= M465), V478 (≠ I466), Y541 (= Y529)
1ozfA The crystal structure of klebsiella pneumoniae acetolactate synthase with enzyme-bound cofactors (see paper)
33% identity, 97% coverage: 4:532/547 of query aligns to 8:537/545 of 1ozfA
- active site: I26 (= I22), G28 (= G24), A29 (≠ E25), K30 (≠ E26), I31 (≠ N27), E51 (= E47), T74 (= T70), H113 (≠ F109), Q114 (= Q110), S115 (≠ I111), Q163 (≠ E159), L253 (= L250), E280 (≠ P277), M385 (≠ N380), Q411 (≠ A406), M413 (= M408), D438 (= D433), D465 (= D460), G467 (= G462), Y468 (= Y463), M470 (= M465), V471 (≠ I466), Q474 (≠ K469), Y534 (= Y529)
- binding magnesium ion: D438 (= D433), D465 (= D460), G467 (= G462)
- binding phosphate ion: G249 (= G246), R250 (≠ T247), Q257 (≠ D254), R343 (≠ K339), R394 (= R389), L396 (≠ Y391), Y397 (≠ R392)
- binding thiamine diphosphate: G386 (= G381), S387 (≠ M382), F388 (≠ Y383), Q411 (≠ A406), M413 (= M408), G437 (= G432), D438 (= D433), G439 (= G434), D465 (= D460), G467 (= G462), Y468 (= Y463), N469 (≠ G464), M470 (= M465), V471 (≠ I466), Y534 (= Y529)
5wdgA Acetolactate synthase from klebsiella pneumoniae in complex with a reaction intermediate
33% identity, 97% coverage: 4:532/547 of query aligns to 9:530/538 of 5wdgA
- active site: I27 (= I22), G29 (= G24), A30 (≠ E25), K31 (≠ E26), I32 (≠ N27), E52 (= E47), T75 (= T70), Q157 (≠ E159), L246 (= L250), E273 (≠ P277), M378 (≠ N380), Q404 (≠ A406), M406 (= M408), D431 (= D433), D458 (= D460), G460 (= G462), Y461 (= Y463), M463 (= M465), V464 (≠ I466), Q467 (≠ K469), Y527 (= Y529)
- binding (2S,3S)-2,3-dihydroxy-3-[(7S,8R,9aS)-8-(2-{[(R)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-2,7-dimethyl-5,7,8,10-tetrahydro-9aH-pyrimido[4,5-d][1,3]thiazolo[3,2-a]pyrimidin-9a-yl]-2-methylbutanoic acid: M378 (≠ N380), S380 (≠ M382), F381 (≠ Y383), Q404 (≠ A406), M406 (= M408), G430 (= G432), D431 (= D433), G432 (= G434), G433 (= G435), D458 (= D460), G460 (= G462), Y461 (= Y463), N462 (≠ G464), M463 (= M465), V464 (≠ I466), Y527 (= Y529)
- binding magnesium ion: R64 (= R59), S117 (≠ E119), T120 (= T122), Q204 (≠ R209), D431 (= D433), D458 (= D460), G460 (= G462)
- binding pyruvic acid: G94 (= G89), R147 (≠ K149)
5dx6A Acetolactate synthase from klebsiella pneumoniae soaked with beta- fluoropyruvate
33% identity, 97% coverage: 4:532/547 of query aligns to 9:533/541 of 5dx6A
- active site: I27 (= I22), G29 (= G24), A30 (≠ E25), K31 (≠ E26), I32 (≠ N27), E52 (= E47), T75 (= T70), Q159 (≠ E159), L249 (= L250), E276 (≠ P277), M381 (≠ N380), Q407 (≠ A406), M409 (= M408), D434 (= D433), D461 (= D460), G463 (= G462), Y464 (= Y463), M466 (= M465), V467 (≠ I466), Q470 (≠ K469), Y530 (= Y529)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-[(1R)-2-fluoro-1-hydroxyethyl]-5-(2-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: M381 (≠ N380), G382 (= G381), S383 (≠ M382), F384 (≠ Y383), Q407 (≠ A406), M409 (= M408), G433 (= G432), D434 (= D433), G435 (= G434), D461 (= D460), G463 (= G462), Y464 (= Y463), N465 (≠ G464), Y530 (= Y529)
- binding magnesium ion: S119 (≠ E119), T122 (= T122), D434 (= D433), D461 (= D460), G463 (= G462)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
31% identity, 97% coverage: 2:532/547 of query aligns to 95:643/667 of P09342
- C161 (= C67) modified: Disulfide link with 307
- P194 (= P100) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A207) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
30% identity, 97% coverage: 2:532/547 of query aligns to 92:640/664 of P09114
- P191 (= P100) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W468) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 8:554/595 of 1t9bB
- active site: Y29 (≠ I22), G31 (= G24), G32 (≠ E25), A33 (≠ E26), I34 (≠ N27), E55 (= E47), T78 (= T70), F117 (= F109), Q118 (= Q110), E119 (≠ I111), K167 (≠ E159), R226 (≠ G214), M262 (≠ L250), V289 (≠ P277), V405 (≠ N380), L430 (= L405), G431 (≠ A406), M433 (= M408), D458 (= D433), N485 (≠ D460), E487 (≠ G462), Q488 (≠ Y463), M490 (= M465), V491 (≠ I466), W494 (= W468), L516 (≠ Y490), G521 (= G495), L522 (≠ A496)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (≠ K99), P108 (= P100), D287 (≠ E275), R288 (≠ K276), M490 (= M465), W494 (= W468)
- binding flavin-adenine dinucleotide: R157 (≠ K149), G215 (≠ A204), A216 (= A205), G217 (= G206), N220 (≠ R209), T242 (= T230), L243 (≠ Q231), Q244 (≠ M232), M259 (≠ T247), L260 (≠ A248), M262 (≠ L250), H263 (≠ S251), G282 (= G270), A283 (≠ H271), R284 (≠ D272), D286 (≠ V274), R288 (≠ K276), V289 (≠ P277), E315 (≠ N293), V316 (= V294), N320 (≠ Q298), G333 (= G311), D334 (= D312), A335 (≠ I313), Q409 (≠ K384), M410 (≠ L385), G428 (≠ N403), G429 (≠ A404)
- binding magnesium ion: D458 (= D433), N485 (≠ D460), E487 (≠ G462)
Sites not aligning to the query:
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 14:560/601 of 6deqA
- active site: Y35 (≠ I22), G37 (= G24), G38 (≠ E25), A39 (≠ E26), I40 (≠ N27), E61 (= E47), T84 (= T70), F123 (= F109), Q124 (= Q110), E125 (≠ I111), K173 (≠ E159), K232 (≠ G214), M268 (≠ L250), V295 (vs. gap), V411 (= V375), L436 (= L405), G437 (≠ A406), M439 (= M408), D464 (= D433), N491 (≠ D460), E493 (≠ G462), Q494 (≠ Y463), M496 (= M465), V497 (≠ I466), W500 (= W468), L522 (≠ Y490), N527 (≠ G495), V528 (≠ A496)
- binding flavin-adenine dinucleotide: R163 (≠ K149), G221 (≠ A204), A222 (= A205), G223 (= G206), N226 (= N208), T248 (= T230), L249 (≠ Q231), Q250 (≠ M232), L266 (≠ A248), G288 (= G270), A289 (≠ H271), R290 (≠ D272), D292 (≠ V274), R294 (≠ K276), V295 (vs. gap), E321 (≠ N293), I322 (≠ V294), D340 (= D312), V341 (≠ I313), M416 (≠ L385), G434 (≠ N403)
- binding magnesium ion: D464 (= D433), N491 (≠ D460), E493 (≠ G462)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (≠ L250), R294 (≠ K276), M496 (= M465), V497 (≠ I466), W500 (= W468)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V375), G412 (= G381), Q413 (≠ M382), H414 (≠ Y383), M439 (= M408), G463 (= G432), D464 (= D433), A465 (≠ G434), S466 (≠ G435), N491 (≠ D460), E493 (≠ G462), Q494 (≠ Y463), G495 (= G464), M496 (= M465), V497 (≠ I466)
Sites not aligning to the query:
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 12:557/598 of 6desA
- active site: Y33 (≠ I22), G35 (= G24), G36 (≠ E25), A37 (≠ E26), I38 (≠ N27), E59 (= E47), T82 (= T70), F121 (= F109), Q122 (= Q110), E123 (≠ I111), K171 (≠ E159), K229 (≠ G214), M265 (≠ L250), V292 (vs. gap), V408 (= V375), L433 (= L405), G434 (≠ A406), M436 (= M408), D461 (= D433), N488 (≠ D460), E490 (≠ G462), Q491 (≠ Y463), M493 (= M465), V494 (≠ I466), W497 (= W468), L519 (≠ Y490), N524 (≠ G495), V525 (≠ A496)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (≠ L250), D290 (≠ E275), R291 (≠ K276), W497 (= W468)
- binding flavin-adenine dinucleotide: R161 (≠ K149), G218 (≠ A204), A219 (= A205), G220 (= G206), N223 (= N208), T245 (= T230), L246 (≠ Q231), Q247 (≠ M232), L263 (≠ A248), G285 (= G270), A286 (≠ H271), R287 (≠ D272), D289 (≠ V274), R291 (≠ K276), V292 (vs. gap), E318 (≠ N293), I319 (≠ V294), N323 (≠ Q298), D337 (= D312), V338 (≠ I313), Q412 (≠ K384), M413 (≠ L385), G431 (≠ N403)
- binding magnesium ion: D461 (= D433), N488 (≠ D460), E490 (≠ G462)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V375), G409 (= G381), Q410 (≠ M382), H411 (≠ Y383), G434 (≠ A406), M436 (= M408), G460 (= G432), D461 (= D433), A462 (≠ G434), S463 (≠ G435), N488 (≠ D460), E490 (≠ G462), Q491 (≠ Y463), G492 (= G464), M493 (= M465), V494 (≠ I466)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 12:557/598 of 6depA
- active site: Y33 (≠ I22), G35 (= G24), G36 (≠ E25), A37 (≠ E26), I38 (≠ N27), E59 (= E47), T82 (= T70), F121 (= F109), Q122 (= Q110), E123 (≠ I111), K171 (≠ E159), K229 (≠ G214), M265 (≠ L250), V292 (vs. gap), V408 (= V375), L433 (= L405), G434 (≠ A406), M436 (= M408), D461 (= D433), N488 (≠ D460), E490 (≠ G462), Q491 (≠ Y463), M493 (= M465), V494 (≠ I466), W497 (= W468), L519 (≠ Y490), N524 (≠ G495), V525 (≠ A496)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (≠ E275), R291 (≠ K276), M493 (= M465), W497 (= W468)
- binding flavin-adenine dinucleotide: R161 (≠ K149), G218 (≠ A204), A219 (= A205), G220 (= G206), N223 (= N208), T245 (= T230), L246 (≠ Q231), Q247 (≠ M232), L263 (≠ A248), G264 (≠ A249), G285 (= G270), A286 (≠ H271), R287 (≠ D272), D289 (≠ V274), R291 (≠ K276), V292 (vs. gap), E318 (≠ N293), I319 (≠ V294), N323 (≠ Q298), D337 (= D312), V338 (≠ I313), M413 (≠ L385), G431 (≠ N403)
- binding magnesium ion: D461 (= D433), N488 (≠ D460), E490 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V375), G409 (= G381), Q410 (≠ M382), H411 (≠ Y383), G434 (≠ A406), M436 (= M408), G460 (= G432), D461 (= D433), A462 (≠ G434), S463 (≠ G435), M466 (= M438), N488 (≠ D460), E490 (≠ G462), Q491 (≠ Y463), G492 (= G464), M493 (= M465), V494 (≠ I466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V375), G409 (= G381), Q410 (≠ M382), H411 (≠ Y383), G434 (≠ A406), M436 (= M408), G460 (= G432), D461 (= D433), A462 (≠ G434), S463 (≠ G435), M466 (= M438), N488 (≠ D460), E490 (≠ G462), Q491 (≠ Y463), G492 (= G464), M493 (= M465), V494 (≠ I466)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 10:552/593 of 6deoA
- active site: Y31 (≠ I22), G33 (= G24), G34 (≠ E25), A35 (≠ E26), I36 (≠ N27), E57 (= E47), T80 (= T70), F119 (= F109), Q120 (= Q110), E121 (≠ I111), K169 (≠ E159), K224 (≠ G214), M260 (≠ L250), V287 (vs. gap), V403 (= V375), L428 (= L405), G429 (≠ A406), M431 (= M408), D456 (= D433), N483 (≠ D460), E485 (≠ G462), Q486 (≠ Y463), M488 (= M465), V489 (≠ I466), W492 (= W468), L514 (≠ Y490), N519 (≠ G495), V520 (≠ A496)
- binding flavin-adenine dinucleotide: R159 (≠ K149), G213 (≠ A204), A214 (= A205), G215 (= G206), N218 (= N208), T240 (= T230), L241 (≠ Q231), Q242 (≠ M232), L258 (≠ A248), G280 (= G270), A281 (≠ H271), R282 (≠ D272), D284 (≠ V274), R286 (≠ K276), V287 (vs. gap), E313 (≠ N293), I314 (≠ V294), N318 (≠ Q298), D332 (= D312), V333 (≠ I313), M408 (≠ L385), G426 (≠ N403)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (≠ L250), D285 (≠ E275), R286 (≠ K276), M488 (= M465), W492 (= W468)
- binding magnesium ion: D456 (= D433), N483 (≠ D460), E485 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V375), G404 (= G381), Q405 (≠ M382), H406 (≠ Y383), G429 (≠ A406), M431 (= M408), G455 (= G432), D456 (= D433), A457 (≠ G434), S458 (≠ G435), M461 (= M438), N483 (≠ D460), E485 (≠ G462), Q486 (≠ Y463), G487 (= G464), M488 (= M465), V489 (≠ I466)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
30% identity, 97% coverage: 1:528/547 of query aligns to 14:559/600 of 6derA
- active site: Y35 (≠ I22), G37 (= G24), G38 (≠ E25), A39 (≠ E26), I40 (≠ N27), E61 (= E47), T84 (= T70), F123 (= F109), Q124 (= Q110), E125 (≠ I111), K173 (≠ E159), K231 (≠ G214), M267 (≠ L250), V294 (vs. gap), V410 (= V375), L435 (= L405), G436 (≠ A406), M438 (= M408), D463 (= D433), N490 (≠ D460), E492 (≠ G462), Q493 (≠ Y463), M495 (= M465), V496 (≠ I466), W499 (= W468), L521 (≠ Y490), N526 (≠ G495), V527 (≠ A496)
- binding flavin-adenine dinucleotide: R163 (≠ K149), G220 (≠ A204), A221 (= A205), G222 (= G206), N225 (= N208), T247 (= T230), L248 (≠ Q231), Q249 (≠ M232), L265 (≠ A248), H268 (≠ S251), G287 (= G270), A288 (≠ H271), R289 (≠ D272), D291 (≠ V274), R293 (≠ K276), V294 (vs. gap), E320 (≠ N293), I321 (≠ V294), N325 (≠ Q298), G338 (= G311), D339 (= D312), V340 (≠ I313), Q414 (≠ K384), M415 (≠ L385), G433 (≠ N403)
- binding Metosulam: R293 (≠ K276), M495 (= M465), W499 (= W468)
- binding magnesium ion: D463 (= D433), N490 (≠ D460), E492 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V375), G411 (= G381), Q412 (≠ M382), H413 (≠ Y383), G436 (≠ A406), M438 (= M408), G462 (= G432), D463 (= D433), A464 (≠ G434), S465 (≠ G435), N490 (≠ D460), E492 (≠ G462), Q493 (≠ Y463), G494 (= G464), M495 (= M465), V496 (≠ I466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V375), G411 (= G381), Q412 (≠ M382), H413 (≠ Y383), G436 (≠ A406), M438 (= M408), G462 (= G432), D463 (= D433), A464 (≠ G434), S465 (≠ G435), M468 (= M438), N490 (≠ D460), E492 (≠ G462), Q493 (≠ Y463), G494 (= G464), V496 (≠ I466)
Sites not aligning to the query:
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
29% identity, 97% coverage: 1:528/547 of query aligns to 12:556/597 of 6demA
- active site: Y33 (≠ I22), G35 (= G24), G36 (≠ E25), A37 (≠ E26), I38 (≠ N27), E59 (= E47), T82 (= T70), F121 (= F109), Q122 (= Q110), E123 (≠ I111), K171 (≠ E159), K228 (≠ G214), M264 (≠ L250), V291 (vs. gap), V407 (= V375), L432 (= L405), G433 (≠ A406), M435 (= M408), D460 (= D433), N487 (≠ D460), E489 (≠ G462), Q490 (≠ Y463), M492 (= M465), V493 (≠ I466), W496 (= W468), L518 (≠ Y490), N523 (≠ G495), V524 (≠ A496)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (≠ L250), D289 (≠ E275), R290 (≠ K276), M492 (= M465), W496 (= W468)
- binding flavin-adenine dinucleotide: R161 (≠ K149), G217 (≠ A204), A218 (= A205), G219 (= G206), N222 (= N208), T244 (= T230), L245 (≠ Q231), Q246 (≠ M232), L262 (≠ A248), G284 (= G270), A285 (≠ H271), R286 (≠ D272), D288 (≠ V274), R290 (≠ K276), V291 (vs. gap), E317 (≠ N293), I318 (≠ V294), N322 (≠ Q298), D336 (= D312), V337 (≠ I313), M412 (≠ L385), G430 (≠ N403)
- binding magnesium ion: D460 (= D433), N487 (≠ D460), E489 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V375), G408 (= G381), Q409 (≠ M382), H410 (≠ Y383), M435 (= M408), G459 (= G432), D460 (= D433), A461 (≠ G434), S462 (≠ G435), M465 (= M438), N487 (≠ D460), E489 (≠ G462), Q490 (≠ Y463), G491 (= G464), M492 (= M465), V493 (≠ I466)
Sites not aligning to the query:
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
29% identity, 97% coverage: 1:528/547 of query aligns to 12:556/597 of 6delA
- active site: Y33 (≠ I22), G35 (= G24), G36 (≠ E25), A37 (≠ E26), I38 (≠ N27), E59 (= E47), T82 (= T70), F121 (= F109), Q122 (= Q110), E123 (≠ I111), K171 (≠ E159), K228 (≠ G214), M264 (≠ L250), V291 (vs. gap), V407 (= V375), L432 (= L405), G433 (≠ A406), M435 (= M408), D460 (= D433), N487 (≠ D460), E489 (≠ G462), Q490 (≠ Y463), M492 (= M465), V493 (≠ I466), W496 (= W468), L518 (≠ Y490), N523 (≠ G495), V524 (≠ A496)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (≠ E275), R290 (≠ K276), W496 (= W468)
- binding flavin-adenine dinucleotide: R161 (≠ K149), G217 (≠ A204), A218 (= A205), G219 (= G206), N222 (= N208), T244 (= T230), L245 (≠ Q231), Q246 (≠ M232), L262 (≠ A248), G284 (= G270), A285 (≠ H271), R286 (≠ D272), D288 (≠ V274), R290 (≠ K276), V291 (vs. gap), E317 (≠ N293), I318 (≠ V294), N322 (≠ Q298), D336 (= D312), V337 (≠ I313), M412 (≠ L385), G430 (≠ N403)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V375), G408 (= G381), Q409 (≠ M382), H410 (≠ Y383), G433 (≠ A406), M435 (= M408), G459 (= G432), D460 (= D433), A461 (≠ G434), S462 (≠ G435), M465 (= M438), N487 (≠ D460), E489 (≠ G462), Q490 (≠ Y463), G491 (= G464), M492 (= M465), V493 (≠ I466)
- binding magnesium ion: D460 (= D433), N487 (≠ D460), E489 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V375), G408 (= G381), Q409 (≠ M382), H410 (≠ Y383), G433 (≠ A406), M435 (= M408), G459 (= G432), D460 (= D433), A461 (≠ G434), S462 (≠ G435), M465 (= M438), N487 (≠ D460), E489 (≠ G462), Q490 (≠ Y463), G491 (= G464), M492 (= M465), V493 (≠ I466)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
29% identity, 97% coverage: 1:528/547 of query aligns to 14:558/599 of 6denA
- active site: Y35 (≠ I22), G37 (= G24), G38 (≠ E25), A39 (≠ E26), I40 (≠ N27), E61 (= E47), T84 (= T70), F123 (= F109), Q124 (= Q110), E125 (≠ I111), K173 (≠ E159), K230 (≠ G214), M266 (≠ L250), V293 (vs. gap), V409 (= V375), L434 (= L405), G435 (≠ A406), M437 (= M408), D462 (= D433), N489 (≠ D460), E491 (≠ G462), Q492 (≠ Y463), M494 (= M465), V495 (≠ I466), W498 (= W468), L520 (≠ Y490), N525 (≠ G495), V526 (≠ A496)
- binding flavin-adenine dinucleotide: R163 (≠ K149), G219 (≠ A204), A220 (= A205), G221 (= G206), N224 (= N208), T246 (= T230), L247 (≠ Q231), Q248 (≠ M232), L264 (≠ A248), G286 (= G270), A287 (≠ H271), R288 (≠ D272), D290 (≠ V274), R292 (≠ K276), V293 (vs. gap), E319 (≠ N293), I320 (≠ V294), N324 (≠ Q298), D338 (= D312), V339 (≠ I313), M414 (≠ L385), G432 (≠ N403)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (≠ L250), D291 (≠ E275), R292 (≠ K276), W498 (= W468)
- binding magnesium ion: D462 (= D433), N489 (≠ D460), E491 (≠ G462)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V375), G410 (= G381), Q411 (≠ M382), H412 (≠ Y383), G435 (≠ A406), M437 (= M408), G461 (= G432), D462 (= D433), A463 (≠ G434), S464 (≠ G435), N489 (≠ D460), E491 (≠ G462), Q492 (≠ Y463), G493 (= G464), M494 (= M465), V495 (≠ I466)
Query Sequence
>208820 MicrobesOnline__882:208820
MNAATLFVRCLEAEGVDHIFGIPGEENLAFLEALRTSSIRLVLTRHEQAAGFMAATYGRL
TGRPGVCLSTLGPGATNLVTAVAYARLGGMPLIVITGQKPIKHSKQGRFQILDVVRMMEP
ITKSTRQVASGSAIPSLVREAFRLAAKEKPGPVHIELPEDIAAEEVATTPHTPSLVRPAQ
ADPELVGEAARRIRKAKRPLLLMAAGANRHDVCGHLRRFIDTTGMFFFSTQMGKGAVDQR
HPRSLGTAALSDHDYLHCAIERADCIVNVGHDVVEKPPFFMHRDDGRTVIHVNVFPAQVD
DVYFPQLEVVGDIGESLQLMADIVGRCPGADDDYLRRIKEHIDAHVYATGLTNSFPPTPQ
SIVSEVREAMPENGVLALDNGMYKLWFARNYRAYAPNTLLLDNALATMGAGLPSALAVAL
LRPGTPVAALCGDGGFMMNSQELETAVRLGVDLTVMVLRDDGYGMIKWKQAGMELPVHGL
DFGNPDFVRYAESYGATGHRVSAPDGLRQTLRRCLATPGVHLIEVPVDYSENEKVFIEEL
RSKTCLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory