SitesBLAST
Comparing 208875 MicrobesOnline__882:208875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
6n2oD 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
30% identity, 83% coverage: 25:241/260 of query aligns to 22:227/291 of 6n2oD
- binding magnesium ion: D101 (= D103), N129 (= N131), I131 (≠ V133)
- binding succinyl-coenzyme a: I57 (= I59), R62 (≠ F64), L134 (≠ M136), K136 (≠ G138)
- binding iron/sulfur cluster: W24 (≠ Y27), C25 (= C28), C28 (= C31), C59 (= C61), C208 (= C222), T210 (= T224), F211 (≠ N225)
- binding thiamine diphosphate: I57 (= I59), G58 (= G60), C59 (= C61), S60 (= S62), H76 (= H78), G102 (= G104), D103 (= D105), N129 (= N131), I131 (≠ V133), G133 (= G135), L134 (≠ M136), T135 (= T137)
6n2oB 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus with 2-oxoglutarate, coenzyme a and succinyl-coa bound (see paper)
30% identity, 83% coverage: 25:241/260 of query aligns to 22:227/291 of 6n2oB
- binding 2-oxoglutaric acid: R62 (≠ F64), L134 (≠ M136)
- binding coenzyme a: K136 (≠ G138), Y150 (≠ T152)
- binding magnesium ion: D101 (= D103), N129 (= N131), I131 (≠ V133)
- binding iron/sulfur cluster: W24 (≠ Y27), C25 (= C28), C28 (= C31), C59 (= C61), C208 (= C222), T210 (= T224), F211 (≠ N225)
- binding thiamine diphosphate: I57 (= I59), G58 (= G60), C59 (= C61), S60 (= S62), H76 (= H78), G102 (= G104), D103 (= D105), N129 (= N131), I131 (≠ V133), Y132 (= Y134), G133 (= G135), L134 (≠ M136), T135 (= T137)
6n2nB Crystal structure of 2-oxoglutarate:ferredoxin oxidoreductase from magnetococcus marinus (see paper)
30% identity, 83% coverage: 25:241/260 of query aligns to 22:227/291 of 6n2nB
- binding magnesium ion: D101 (= D103), N129 (= N131), I131 (≠ V133)
- binding iron/sulfur cluster: W24 (≠ Y27), C25 (= C28), C28 (= C31), H30 (= H33), C59 (= C61), C208 (= C222), T210 (= T224), F211 (≠ N225)
- binding thiamine diphosphate: I57 (= I59), G58 (= G60), C59 (= C61), S60 (= S62), H76 (= H78), G100 (= G102), D101 (= D103), G102 (= G104), D103 (= D105), N129 (= N131), I131 (≠ V133), Y132 (= Y134), G133 (= G135), L134 (≠ M136), T135 (= T137)
5b46B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - ligand free form (see paper)
32% identity, 76% coverage: 27:224/260 of query aligns to 8:196/301 of 5b46B
- binding magnesium ion: D87 (= D103), N115 (= N131), V117 (= V133)
- binding iron/sulfur cluster: W8 (≠ Y27), C9 (= C28), C12 (= C31), C43 (= C61), C194 (= C222), T196 (= T224)
- binding thiamine diphosphate: I41 (= I59), G42 (= G60), C43 (= C61), S44 (= S62), H62 (= H78), G86 (= G102), G88 (= G104), D89 (= D105), N115 (= N131), V117 (= V133), Y118 (= Y134), G119 (= G135), L120 (≠ M136), T121 (= T137)
Sites not aligning to the query:
Q96XT4 2-oxoacid:ferredoxin oxidoreductase 2, subunit beta; OFOR2; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see paper)
32% identity, 76% coverage: 27:224/260 of query aligns to 11:199/304 of Q96XT4
Q96Y68 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; OFOR1; EC 1.2.7.11 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 2 papers)
32% identity, 76% coverage: 27:224/260 of query aligns to 11:199/305 of Q96Y68
- C12 (= C28) binding
- C15 (= C31) binding
- C46 (= C61) binding
- K49 (≠ F64) mutation to I: Loss of oxidoreductase activity toward 2-oxoglutarate but retains its activity toward pyruvate.
- D90 (= D103) binding
- GD 91:92 (= GD 104:105) binding
- N118 (= N131) binding
- V120 (= V133) binding
- GL 122:123 (≠ GM 135:136) binding
- K125 (≠ G138) Plays an important role in the binding of CoA; mutation to A: Shows a strong decrease of affinity for CoA and a poor inactivation by 4-fluoro-7-nitrobenzofurazan (NBD-F).
- K173 (= K191) mutation to A: Same oxidoreductase activity as the wild-type.
- C197 (= C222) binding
P72579 2-oxoacid:ferredoxin oxidoreductase subunit beta; OFOR; EC 1.2.7.11 from Sulfolobus sp. (see paper)
32% identity, 76% coverage: 27:224/260 of query aligns to 11:199/305 of P72579
- K49 (≠ F64) mutation to I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to R: Increase the oxidoreductase activity with pyruvate.; mutation to V: Slight decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.
- L123 (≠ M136) mutation L->A,I: Strong decrease of the oxidoreductase activity with pyruvate, 2-oxobutyrate and 2-oxoglutarate.; mutation to N: Strong decrease of the oxidoreductase activity with pyruvate and 2-oxobutyrate. However, this mutant shows almost the same activity with 2-oxoglutarate as the wild-type.
5b48B 2-oxoacid:ferredoxin oxidoreductase 1 from sulfolobus tokodai (see paper)
30% identity, 78% coverage: 27:228/260 of query aligns to 7:196/286 of 5b48B
- binding magnesium ion: D84 (= D103), N112 (= N131), V114 (= V133)
- binding iron/sulfur cluster: C8 (= C28), C11 (= C31), C42 (= C61), C183 (= C222), T185 (= T224)
- binding 2-[(2E)-3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-(1-oxidanylpropylidene)-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: I40 (= I59), G41 (= G60), C42 (= C61), S43 (= S62), H59 (= H78), G85 (= G104), D86 (= D105), N112 (= N131), V114 (= V133), Y115 (= Y134), G116 (= G135), L117 (≠ M136)
5b47B 2-oxoacid:ferredoxin oxidoreductase 2 from sulfolobus tokodai - pyruvate complex (see paper)
29% identity, 79% coverage: 27:231/260 of query aligns to 4:190/275 of 5b47B
- binding magnesium ion: D83 (= D103), N111 (= N131)
- binding iron/sulfur cluster: C5 (= C28), C8 (= C31), C39 (= C61), C179 (= C222)
- binding thiamine diphosphate: I37 (= I59), G38 (= G60), C39 (= C61), S40 (= S62), H58 (= H78), G84 (= G104), D85 (= D105), N111 (= N131), V113 (= V133), Y114 (= Y134), L116 (≠ M136)
5exdF Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-di-oxido-methyl-tpp (coom-tpp) intermediate (see paper)
26% identity, 79% coverage: 28:232/260 of query aligns to 24:235/310 of 5exdF
- active site: N143 (≠ M136)
- binding magnesium ion: D110 (= D103), N138 (= N131), S140 (≠ V133)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-4-methyl-2-[1,1,2-tris(oxidanyl)-2-oxidanylidene-ethyl]-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I59), G51 (= G60), C52 (= C61), I74 (≠ H78), D110 (= D103), G111 (= G104), Y136 (≠ V129), N138 (= N131), S140 (≠ V133), Y141 (= Y134), A142 (≠ G135), N143 (≠ M136), T144 (= T137)
- binding iron/sulfur cluster: C24 (= C28), C27 (= C31), P29 (≠ H33), C52 (= C61), A142 (≠ G135), C225 (= C222), K227 (≠ T224)
5exeC Crystal structure of oxalate oxidoreductase from moorella thermoacetica bound with carboxy-tpp adduct (see paper)
26% identity, 79% coverage: 28:232/260 of query aligns to 24:235/314 of 5exeC
- active site: N143 (≠ M136)
- binding [2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-carboxy-4-methyl-1,3-thiazol-3-ium-5-yl]ethoxy-oxidanyl-phosphoryl] hydrogen phosphate: T50 (≠ I59), G51 (= G60), C52 (= C61), I74 (≠ H78), G109 (= G102), D110 (= D103), G111 (= G104), Y136 (≠ V129), N138 (= N131), S140 (≠ V133), Y141 (= Y134), A142 (≠ G135), N143 (≠ M136), T144 (= T137)
- binding magnesium ion: D110 (= D103), D130 (≠ R123), N138 (= N131), S140 (≠ V133), L211 (= L200), Q213 (≠ D210)
- binding iron/sulfur cluster: C24 (= C28), C27 (= C31), P29 (≠ H33), C52 (= C61), C225 (= C222), P226 (= P223), K227 (≠ T224)
5c4iC Structure of an oxalate oxidoreductase (see paper)
26% identity, 79% coverage: 28:232/260 of query aligns to 24:235/312 of 5c4iC
- active site: N143 (≠ M136)
- binding magnesium ion: D110 (= D103), N138 (= N131), S140 (≠ V133)
- binding iron/sulfur cluster: C24 (= C28), C27 (= C31), P29 (≠ H33), C52 (= C61), A142 (≠ G135), C225 (= C222), P226 (= P223), K227 (≠ T224)
- binding thiamine diphosphate: T50 (≠ I59), G51 (= G60), C52 (= C61), I74 (≠ H78), G109 (= G102), D110 (= D103), G111 (= G104), Y136 (≠ V129), N138 (= N131), S140 (≠ V133), Y141 (= Y134), A142 (≠ G135), N143 (≠ M136), T144 (= T137)
Query Sequence
>208875 MicrobesOnline__882:208875
MQAHELREDETVAFDVPELLVDRATHYCPGCHHGVAHRLVAEVLTEMGVAEDTICVSSIG
CSVFIYNYLAVDTVEAPHGRAPAVATGVKRARKDKIVFAYQGDGDLASIGLAEIMHAANR
GERMTIVFVNNTVYGMTGGQMAPTTLVGQKTTTCPSGRCRDTEGLPMKMAEIIAGLGGVA
YSARVSLDSVKHIRAAKKALRKAFDVQQNDLGFGFVEMLSACPTNWRMDAVKANKRIAEE
MIPYFPLGVYKDVTEAEGVC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory