Comparing 208937 FitnessBrowser__DvH:208937 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
8y4wA Sialic acid bound form of tripartite atp-independent periplasmic (trap) transporter from fusobacterium nucleatum.
28% identity, 60% coverage: 32:144/188 of query aligns to 18:130/612 of 8y4wA
Sites not aligning to the query:
>208937 FitnessBrowser__DvH:208937
MCALRLTARLLDTASEKADRAARLWLITAMAGMAVLVAVQVFSRYALNESLFWSEELGRI
LLVQLTFIGCAVAVRAGAHPGMDALVRHLPRRGRHVTHMLVLLAALAFFALLAWHGARFA
WFVRHQSTPALGLSRLIPALPLPVGGALSMLHVLAILARHATGDRQGGGDDGLADHASDT
PSPTGDRP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory