Comparing 209006 MicrobesOnline__882:209006 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
5uhsA Structure of a semisweet d57a mutant (see paper)
39% identity, 68% coverage: 6:82/113 of query aligns to 3:79/81 of 5uhsA
B0SR19 Sugar transporter SemiSWEET from Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) (see paper)
36% identity, 73% coverage: 6:88/113 of query aligns to 3:85/85 of B0SR19
P0DMV3 Sugar transporter SemiSWEET from Escherichia coli (strain UMEA 3162-1) (see paper)
33% identity, 71% coverage: 3:82/113 of query aligns to 2:81/89 of P0DMV3
>209006 MicrobesOnline__882:209006
MPDTLDLIGYAAGLLTSLAYVPQVVRLWRTRSVADISLPTFCLLTVGIGLWLLYGMGREA
GPVIVANAVGMLLTLAIVVMKLWFGRHSAQATDEGIGHPVRQDAAKPHLRRDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory