SitesBLAST
Comparing 209013 MicrobesOnline__882:209013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
66% identity, 92% coverage: 16:396/414 of query aligns to 1:381/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H96), K82 (= K97), Q109 (= Q124), S185 (= S200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), E345 (= E360), S371 (= S386), G372 (= G387)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:378/386 of 1v8zA
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding pyridoxal-5'-phosphate: H81 (= H96), K82 (= K97), Q109 (= Q124), S185 (= S200), G227 (= G242), G228 (= G243), G229 (= G244), S230 (= S245), N231 (= N246), E345 (= E360), S371 (= S386), G372 (= G387)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
61% identity, 93% coverage: 17:402/414 of query aligns to 2:387/388 of 5dw0A
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), S185 (= S200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), D300 (= D315), E345 (= E360), S371 (= S386)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:378/385 of 6am8B
- active site: K82 (= K97), E104 (= E119), S371 (= S386)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H96), K82 (= K97), E104 (= E119), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), L161 (= L176), S185 (= S200), V187 (= V202), G227 (= G242), G228 (= G243), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), Y301 (= Y316), E345 (= E360), S371 (= S386), G372 (= G387)
- binding tryptophan: P12 (= P27), L169 (= L184), S274 (≠ L289), H275 (= H290)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:377/383 of 5dw3A
- active site: K82 (= K97), E104 (= E119), S370 (= S386)
- binding tryptophan: K82 (= K97), E104 (= E119), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), S185 (= S200), G228 (= G243), Y300 (= Y316)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
61% identity, 91% coverage: 17:393/414 of query aligns to 2:378/384 of 7rnpA
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
61% identity, 94% coverage: 17:404/414 of query aligns to 2:387/394 of 5ixjD
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
61% identity, 91% coverage: 17:393/414 of query aligns to 2:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), S185 (= S200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), E345 (= E360), S371 (= S386)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
61% identity, 91% coverage: 17:393/414 of query aligns to 2:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), S185 (= S200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G298 (= G313), E345 (= E360), S371 (= S386)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
62% identity, 91% coverage: 17:393/414 of query aligns to 2:376/383 of 5vm5D
- active site: K82 (= K97), E104 (= E119), S369 (= S386)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H96), K82 (= K97), T105 (= T120), G106 (= G121), A107 (= A122), Q109 (= Q124), H110 (= H125), S185 (= S200), G227 (= G242), G229 (= G244), S230 (= S245), N231 (= N246), G296 (= G313), E343 (= E360), S369 (= S386)
7lv5B The internal aldimine form of the wild-type salmonella typhimurium tryptophan synthase in complex with inhibitor n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9f) at the enzyme alpha-site, cesium ion at the metal coordination site and l-histidine at the enzyme beta-site at 1.55 angstrom resolution
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/393 of 7lv5B
- binding histidine: K86 (= K97), E108 (= E119), T109 (= T120), G110 (= G121), Q113 (= Q124), H114 (= H125), L165 (= L176)
- binding pyridoxal-5'-phosphate: H85 (= H96), K86 (= K97), T189 (≠ S200), G231 (= G242), G233 (= G244), S234 (= S245), N235 (= N246), E349 (= E360), S376 (= S386), G377 (= G387)
3cepB Structure of a tryptophan synthase quinonoid intermediate (see paper)
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/393 of 3cepB
- binding indoline: K86 (= K97), L165 (= L176), T189 (≠ S200), G232 (= G243), F305 (≠ Y316)
- binding 3-hydroxy-2-iminopropanoic acid: K86 (= K97), T109 (= T120), G110 (= G121), A111 (= A122), G112 (= G123), Q113 (= Q124), H114 (= H125)
- binding pyridoxal-5'-phosphate: H85 (= H96), K86 (= K97), T189 (≠ S200), G231 (= G242), G232 (= G243), G233 (= G244), S234 (= S245), N235 (= N246), G302 (= G313), E349 (= E360), S376 (= S386), G377 (= G387)
8b05B Tryptophan synthase - cryo-trapping by the spitrobot crystal plunger after 20 sec (see paper)
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/394 of 8b05B
- binding indole: A213 (= A224), Q214 (= Q225)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H85 (= H96), K86 (= K97), T109 (= T120), G110 (= G121), Q113 (= Q124), H114 (= H125), T189 (≠ S200), G231 (= G242), G232 (= G243), G233 (= G244), S234 (= S245), N235 (= N246), G302 (= G313), D304 (= D315), E349 (= E360), S376 (= S386)
2j9xB Tryptophan synthase in complex with gp, alpha-d,l-glycerol- phosphate, cs, ph6.5 - alpha aminoacrylate form - (gp)e(a- a) (see paper)
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/394 of 2j9xB
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H85 (= H96), K86 (= K97), T109 (= T120), G110 (= G121), A111 (= A122), Q113 (= Q124), H114 (= H125), T189 (≠ S200), G231 (= G242), G233 (= G244), S234 (= S245), N235 (= N246), G302 (= G313), E349 (= E360), S376 (= S386), G377 (= G387)
5cgqB Crystal structure of tryptophan synthase from salmonella typhimurium in complex with f9 ligand in the alpha-site and the product l- tryptophan in the beta-site.
57% identity, 95% coverage: 6:400/414 of query aligns to 1:390/390 of 5cgqB
- active site: K86 (= K97), E108 (= E119), S376 (= S386)
- binding pyridoxal-5'-phosphate: H85 (= H96), K86 (= K97), T189 (≠ S200), G231 (= G242), G233 (= G244), S234 (= S245), N235 (= N246), E349 (= E360), S376 (= S386), G377 (= G387)
- binding tryptophan: K86 (= K97), E108 (= E119), T109 (= T120), G110 (= G121), A111 (= A122), Q113 (= Q124), H114 (= H125), L165 (= L176), T189 (≠ S200), F305 (≠ Y316)
1qopB Crystal structure of wild-type tryptophan synthase complexed with indole propanol phosphate (see paper)
57% identity, 95% coverage: 6:400/414 of query aligns to 1:390/390 of 1qopB
- binding sodium ion: G231 (= G242), P269 (≠ T280), F305 (≠ Y316), S307 (≠ G318)
- binding pyridoxal-5'-phosphate: A84 (= A95), H85 (= H96), K86 (= K97), T189 (≠ S200), G231 (= G242), G233 (= G244), S234 (= S245), N235 (= N246), E349 (= E360), S376 (= S386), G377 (= G387)
4kkxB Crystal structure of tryptophan synthase from salmonella typhimurium with 2-aminophenol quinonoid in the beta site and the f6 inhibitor in the alpha site (see paper)
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/395 of 4kkxB
- active site: K86 (= K97), E108 (= E119), S376 (= S386)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-3-[(2-hydroxyphenyl)amino]-D-alanine: H85 (= H96), K86 (= K97), E108 (= E119), T109 (= T120), G110 (= G121), A111 (= A122), Q113 (= Q124), H114 (= H125), L165 (= L176), T189 (≠ S200), G231 (= G242), G232 (= G243), G233 (= G244), S234 (= S245), N235 (= N246), G302 (= G313), F305 (≠ Y316), E349 (= E360), S376 (= S386), G377 (= G387)
4hpxB Crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site (see paper)
56% identity, 96% coverage: 6:401/414 of query aligns to 1:391/395 of 4hpxB
- active site: K86 (= K97), E108 (= E119), S376 (= S386)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H85 (= H96), K86 (= K97), T109 (= T120), G110 (= G121), A111 (= A122), G112 (= G123), Q113 (= Q124), H114 (= H125), T189 (≠ S200), G231 (= G242), G232 (= G243), G233 (= G244), S234 (= S245), N235 (= N246), G302 (= G313), E349 (= E360), S376 (= S386), G377 (= G387)
- binding benzimidazole: T2 (= T7), L4 (≠ H9), N5 (≠ R10), K86 (= K97), E108 (= E119), A135 (= A146), K136 (≠ E147), L165 (= L176), G188 (= G199), T189 (≠ S200), G231 (= G242), G232 (= G243), F305 (≠ Y316)
Query Sequence
>209013 MicrobesOnline__882:209013
MTATATTLHRPDTSTGFFGAYGGQFVPDQLKPILDDLAATFDACKDDPSFIEEFTYYLTR
YSGRATPLFLCSNLTARLGGARIYLKREDLNHLGAHKVNNTIGQILLAKRMGKKKVIAET
GAGQHGVATAATAALMGMQCTIYMGAEDMERQKLNVFRMRMMGAEVVPAMSGQRTLKEAV
DEALAAWVQDANETFYLLGSAVGPHPYPAIVRHFQSVIGREARAQILEAEGRLPDCCIAC
VGGGSNAIGLFAEFVPDTSVRLIGVEPAGRGLTYGDHAATLCLGEPGVLHGFYSYMLKDD
KGEAAAVYSISAGLDYPGVGPEHSHLKDMNRAEYVSVTDVEAVDAFFTLSRAEGIIPALE
SSHALAHAMKMAPAMPKDAIIVVNLSGRGDKDVAQIEEMVSNGLVTPPAMVRGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory