SitesBLAST
Comparing 209017 MicrobesOnline__882:209017 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07117 Sodium/proline symporter; Proline carrier; Proline permease; Propionate transporter from Escherichia coli (strain K12) (see 4 papers)
28% identity, 91% coverage: 34:482/495 of query aligns to 28:477/502 of P07117
- R257 (= R265) mutation to C: Sodium-independent binding affinity for proline.
- C281 (= C292) mutation to S: Does not affect proline uptake activity. Confers resistance to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- C344 (≠ S344) mutation to S: Small decrease in proline uptake activity. Confers resistance to N-ethylmaleimide. Exhibits low Na(+)-dependent proline binding.
- C349 (≠ A349) mutation to S: Does not affect proline uptake activity. Sensitive to N-ethylmaleimide. Na(+)-dependent proline binding activity is similar to wild-type carrier.
- R376 (= R377) mutation R->E,Q: No change in activity.; mutation to K: Loss of activity.
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
27% identity, 75% coverage: 13:382/495 of query aligns to 22:387/643 of Q92911
- A102 (≠ G101) natural variant: A -> P
- H226 (≠ P228) mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- D237 (≠ Q242) mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- Y242 (≠ L246) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- T243 (≠ S247) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
Sites not aligning to the query:
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
8hg7A Structure of human sglt2-map17 complex with sotagliflozin (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 12:394/590 of 8hg7A
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: N55 (≠ Y62), G59 (= G66), H60 (≠ S67), G63 (= G70), L64 (≠ G71), E79 (≠ Q89), V266 (≠ L251), S267 (≠ V252), Y270 (≠ G255), W271 (≠ V256), K301 (≠ L285)
- binding sodium ion: A53 (= A60), S54 (= S61), I56 (≠ T63), G57 (≠ S64), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: 433, 437
- binding : 579, 583, 584, 587, 588
8hdhA Structure of human sglt2-map17 complex with canagliflozin (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 12:394/586 of 8hdhA
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ Y62), G59 (= G66), H60 (≠ S67), G63 (= G70), L64 (≠ G71), F78 (≠ I88), E79 (≠ Q89), S267 (≠ V252), W271 (≠ V256)
- binding sodium ion: A53 (= A60), S54 (= S61), I56 (≠ T63), G57 (≠ S64), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 434, 437, 506
- binding : 575, 579, 580, 583, 584
8hb0A Structure of human sglt2-map17 complex with ta1887 (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 12:394/586 of 8hb0A
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ Y62), H60 (≠ S67), G63 (= G70), L64 (≠ G71), T67 (≠ V74), V75 (≠ L85), F78 (≠ I88), E79 (≠ Q89), V137 (≠ A147), V266 (≠ L251), S267 (≠ V252), W271 (≠ V256)
- binding sodium ion: A53 (= A60), I56 (≠ T63), G57 (≠ S64), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 575, 576, 579, 580, 583, 584
8hezA Structure of human sglt2-map17 complex with dapagliflozin (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 12:394/582 of 8hezA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ Y62), G59 (= G66), H60 (≠ S67), G63 (= G70), L64 (≠ G71), T67 (≠ V74), F78 (≠ I88), E79 (≠ Q89), V266 (≠ L251), S267 (≠ V252), W271 (≠ V256), K301 (≠ I290)
- binding sodium ion: A53 (= A60), I56 (≠ T63), G57 (≠ S64), A369 (= A337), S372 (= S340), S373 (≠ T341)
Sites not aligning to the query:
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 433, 437
- binding : 568, 571, 572, 575, 576, 579, 580
7vsiA Structure of human sglt2-map17 complex bound with empagliflozin (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 12:394/586 of 7vsiA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (≠ Y62), H60 (≠ S67), G63 (= G70), L64 (≠ G71), V75 (≠ L85), F78 (≠ I88), E79 (≠ Q89), V266 (≠ L251), S267 (≠ V252), Y270 (≠ G255)
Sites not aligning to the query:
P31639 Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2 from Homo sapiens (Human) (see paper)
25% identity, 71% coverage: 14:362/495 of query aligns to 32:414/672 of P31639
- V95 (≠ L85) mutation to A: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F98 (≠ I88) mutation to A: Slightly decreases D-glucose transporter activity. Abolishes the binding to inhibitor, empagliflozin.
- V157 (≠ A147) mutation to A: Decreases D-glucose transporter activity.
- L283 (≠ F248) mutation to M: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
Sites not aligning to the query:
- 453 F→A: Slightly decreases D-glucose transporter activity. Greatly reduces the binding to inhibitor, empagliflozin.
7sl8A Cryoem structure of sglt1 at 3.4 a resolution (see paper)
23% identity, 86% coverage: 11:434/495 of query aligns to 13:453/582 of 7sl8A
Sites not aligning to the query:
7slaA Cryoem structure of sglt1 at 3.15 angstrom resolution (see paper)
23% identity, 86% coverage: 11:434/495 of query aligns to 14:454/585 of 7slaA
Sites not aligning to the query:
P11170 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
25% identity, 86% coverage: 11:434/495 of query aligns to 32:485/662 of P11170
- C255 (vs. gap) modified: Disulfide link with 608
- Q457 (vs. gap) mutation to W: Drasticly decreased affinity for glucose and phlorizin.
- T460 (≠ F407) mutation to W: Decreased affinity for glucose and phlorizin.
Sites not aligning to the query:
- 608 modified: Disulfide link with 255
Q8N695 Sodium-coupled monocarboxylate transporter 1; Apical iodide transporter; Electrogenic sodium monocarboxylate cotransporter; Sodium iodide-related cotransporter; Solute carrier family 5 member 8 from Homo sapiens (Human) (see 3 papers)
23% identity, 90% coverage: 30:475/495 of query aligns to 33:479/610 of Q8N695
- V193 (≠ G195) to I: in dbSNP:rs1709189
- F251 (vs. gap) to V: in dbSNP:rs11834933
Sites not aligning to the query:
- 608 T→A: Loss of interaction with PDZK1.
- 608:610 PDZ-binding
- 610 L→A: Loss of interaction with PDZK1.
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
21% identity, 87% coverage: 11:442/495 of query aligns to 32:493/659 of Q9NY91
- E457 (≠ G411) mutation to Q: Confers sugar transport activity not found in the wild-type protein. Increased sensitivity to inhibitor phlorizin.
7wmvA Structure of human sglt1-map17 complex bound with lx2761 (see paper)
24% identity, 86% coverage: 11:434/495 of query aligns to 15:468/602 of 7wmvA
- binding N-[2-(dimethylamino)ethyl]-2-methyl-2-[4-[4-[[2-methyl-5-[(2S,3R,4R,5S,6R)-6-methylsulfanyl-3,4,5-tris(oxidanyl)oxan-2-yl]phenyl]methyl]phenyl]butanoylamino]propanamide: N61 (≠ Y62), H66 (≠ S67), L70 (vs. gap), I81 (vs. gap), F84 (≠ L80), L257 (vs. gap), M266 (≠ L254), L269 (= L257), T270 (≠ G258), Y273 (vs. gap), W274 (vs. gap), F436 (vs. gap), D437 (= D399), Q440 (≠ V402)
Sites not aligning to the query:
Q9Y289 Sodium-dependent multivitamin transporter; Na(+)-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6 from Homo sapiens (Human) (see 10 papers)
23% identity, 85% coverage: 33:452/495 of query aligns to 50:474/635 of Q9Y289
- C68 (≠ G51) mutation to A: No effect on biotin transport.
- T78 (≠ S61) mutation to A: Reduced membrane localization. Decrease in biotin transport.
- C104 (≠ M87) mutation to A: No effect on biotin transport.
- R123 (= R110) to L: in SMVTD; reduced membrane localization; impaired biotin transport
- S128 (≠ T115) mutation to A: No effect on biotin transport.
- N138 (≠ H127) mutation to A: Reduced protein levels. Decrease in biotin transport.
- C144 (= C133) mutation to A: No effect on biotin transport.
- Y162 (≠ G151) to C: in COMNB; no effect on membrane localization
- C187 (≠ V175) mutation to A: No effect on biotin transport.
- S242 (≠ T232) mutation to A: No effect on biotin transport.
- S283 (≠ G268) mutation to A: No effect on protein levels or membrane localization.
- T286 (≠ D271) mutation to A: Resistant to phorbol 12-myristate 13-acetate (PMA)-induced inhibition of biotin transport. No effect on protein levels or membrane localization.
- C294 (vs. gap) mutation to A: Reduced membrane localization. Decrease in biotin transport (decreased Vmax, no change in Km).; mutation C->S,M: Decrease in biotin transport.
- C309 (≠ T283) mutation to A: No effect on biotin transport.
- C358 (≠ G333) mutation to A: No effect on biotin transport.
- T366 (= T341) mutation to A: No effect on biotin transport.
- R400 (= R377) to T: in SMVTD; impaired biotin transport; dbSNP:rs370950187
- C410 (≠ G387) mutation to A: No effect on biotin transport.
- S429 (≠ N405) to G: in COMNB; no effect on membrane localization
- C443 (≠ V421) mutation to A: No effect on biotin transport.
- C450 (≠ R428) mutation to A: No effect on biotin transport.
Sites not aligning to the query:
- 94:635 natural variant: Missing (in SMVTD and COMNB; reduced membrane localization; impaired biotin transport; dbSNP:rs994218778)
- 481 S → F: in dbSNP:rs1395
- 489 N→A: Slight decrease in protein levels. Decrease in biotin transport.
- 498 N→A: No effect on biotin transport.
- 534 N→A: No effect on biotin transport.
- 567:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 570:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 575:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 577 C→A: No effect on biotin transport.
- 583 C→A: No effect on biotin transport.
- 584:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 600:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 612:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 616:635 mutation Missing: Loss of apical membrane localization in polarized cells. Basolateral localization in polarized cells.
- 620:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 624:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 627 T→A: No effect on biotin transport.
- 628 mutation C->A,S: Decrease in biotin transport.
- 632:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
P13866 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Homo sapiens (Human) (see 6 papers)
24% identity, 86% coverage: 11:434/495 of query aligns to 32:485/664 of P13866
- N51 (≠ A30) to S: in GGM; slightly decreased activity; dbSNP:rs17683011
- W67 (≠ G51) mutation to A: Strong reduction in D-glucose transporter activity.
- S77 (= S61) mutation to A: Loss of activity.
- H83 (≠ S67) mutation to L: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and C-290.; mutation to Q: Loss of D-glucose transporter activity.
- R135 (= R123) to W: in GGM; loss of activity
- S159 (≠ L146) to P: in GGM; loss of activity
- A166 (= A153) to T: in GGM; about 90% reduction in activity
- D204 (= D191) mutation to A: Loss of activity.
- N248 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Loss of N-glycosylation.
- C255 (≠ V240) modified: Disulfide link with 511
- W276 (vs. gap) to L: in GGM; about 95% reduction in activity
- T287 (≠ G258) mutation to A: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with L-83 and C-290.; mutation to N: Loss of D-glucose transporter activity. Has strict selectivity for D-galactose.; mutation T->S,A: Has normal D-glucose and D-galactose transporter activity.
- Y290 (vs. gap) mutation to C: Loss of D-galactose transporter activity. Has strict selectivity for D-glucose. Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and L-83.
- W291 (vs. gap) mutation to A: Loss of D-glucose transporter activity.
- C292 (vs. gap) to Y: in GGM; loss of activity; mutation to A: Has no effect on water permeability.
- Q295 (≠ P260) to R: in GGM; loss of activity
- R300 (= R265) to S: in GGM; loss of activity
- A304 (≠ Y269) to V: in GGM; impairs trafficking to the plasma membrane
- K321 (≠ I290) mutation to Q: Acquires D-mannose and D-allose transporter activity comparable to glucose and galactose.
- C345 (≠ A302) modified: Disulfide link with 351
- C351 (vs. gap) modified: Disulfide link with 345
- C355 (vs. gap) modified: Disulfide link with 361
- C361 (≠ A309) modified: Disulfide link with 355
- N363 (≠ D311) mutation to A: Loss of water permeation.
- L369 (= L317) to S: in GGM; loss of activity
- R379 (≠ A327) to Q: in GGM; loss of activity
- A388 (= A336) to V: in GGM; loss of activity
- S396 (= S344) mutation to A: Loss of activity.
- F405 (≠ I353) to S: in GGM; loss of activity
- A411 (≠ V359) to T: in GGM; slightly decreased activity; dbSNP:rs17683430
- G426 (≠ S382) to R: in GGM; loss of activity
- Q451 (vs. gap) mutation to A: Strong reduction in water permeation.
- L452 (vs. gap) mutation to A: Loss of water permeation.
- D454 (= D399) mutation to A: Has no effect on water permeation.
- Q457 (≠ V402) mutation to A: Loss of D-glucose transporter activity.; mutation to C: Strong reduction in D-glucose transporter activity.
- T460 (≠ N405) mutation to A: Loss of D-glucose transporter activity.
- V470 (= V415) to N: in GGM; about 90% reduction in activity; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 191:664 natural variant: Missing (in GGM; loss of activity)
- 379:664 natural variant: Missing (in GGM; loss of activity)
- 499 R → H: in GGM; impairs trafficking to the plasma membrane; decreases the sugar affinity
- 511 modified: Disulfide link with 255
- 517 modified: Disulfide link with 522
- 522 modified: Disulfide link with 517
- 615 H → Q: in GGM; slightly decreased activity
- 641 W→A: Slightly reduced D-glucose transporter activity.
- 660:661 HA→WG: Loss of D-glucose transporter activity.
Q9ET37 Solute carrier family 5 member 4A; SGLT3-a from Mus musculus (Mouse) (see paper)
23% identity, 73% coverage: 11:370/495 of query aligns to 32:422/656 of Q9ET37
Sites not aligning to the query:
- 457 E→Q: Confers sodium-dependent sugar transport activity not found in the wild type protein.
8hinA Structure of human sglt2-map17 complex with phlorizin (see paper)
24% identity, 71% coverage: 14:362/495 of query aligns to 19:390/588 of 8hinA
- binding 1-[2-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-4,6-bis(oxidanyl)phenyl]-3-(4-hydroxyphenyl)propan-1-one: S46 (≠ T57), A49 (= A60), S50 (= S61), G53 (≠ S64), D177 (= D191), T181 (≠ G195), R276 (= R265), S369 (≠ T341)
Sites not aligning to the query:
Q9GZV3 High affinity choline transporter 1; hCHT1; Hemicholinium-3-sensitive choline transporter; CHT; Solute carrier family 5 member 7 from Homo sapiens (Human) (see 5 papers)
27% identity, 71% coverage: 9:358/495 of query aligns to 9:364/580 of Q9GZV3
- D48 (≠ S48) to G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039768
- G65 (≠ A65) to E: in CMS20; loss of choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039765
- I89 (≠ T92) to V: 40% reduction in choline transmembrane transporter activity; found in 0.06 of Ashkenazi Jews; dbSNP:rs1013940; mutation to A: Decreased choline transmembrane transporter activity, only 20% of wild-type choline uptake activity.
- P105 (≠ V107) to S: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs886039766
- Y111 (≠ A113) to H: in CMS20; no effect on localization at plasma membrane
- Y175 (= Y178) to C: in CMS20; uncertain significance; dbSNP:rs1331713195
- I291 (≠ A296) to T: in CMS20; uncertain significance; dbSNP:rs375397889
- V344 (≠ I338) to L: in CMS20; uncertain significance
- R361 (≠ K355) to Q: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane; dbSNP:rs147656110
Sites not aligning to the query:
- 418 F → V: in CMS20; uncertain significance
- 446 R → G: in CMS20; decreased choline transmembrane transporter activity; no effect on localization at plasma membrane
- 451 E→Q: Decreased choline transmembrane transporter activity, only 5% of wild-type choline uptake activity.
- 527:532 Dileucine-like motif
- 530 I→A: No change in protein internalization. No change in choline transmembrane transporter activity.
- 531 L→A: Loss of protein internalization to vesicular structures in neurons. Increased choline transmembrane transporter activity.
- 531:532 LV→AA: Decreased protein internalization; when associated with V-538. Increased choline transmembrane transporter activity; when associated with V-538.
- 532 V→A: Decreased protein internalization. Increased choline transmembrane transporter activity.
- 538 K→V: Decreased protein internalization; when associated with 531-L-V-532. Increased choline transmembrane transporter activity; when associated with 531-L-V-532.
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
23% identity, 91% coverage: 46:495/495 of query aligns to 19:488/512 of 3dh4A
Query Sequence
>209017 MicrobesOnline__882:209017
MSAQFMTTVPVVLYLALSFGVALWARGRTAEGGSAKDIIEEYYIGGRSMGGFVLAMTIIA
SYTSAGSFVGGPGVAYRLGLSWVLLAMIQVPTTFLTLGVLGKRFAIVARRAGAVTLTDYL
LARYRSHTVVILCSAALLVFFMAAMLAQFIGGARLFQTVTGYPYVVGLALFGVTVVLYTA
VGGFRAVVVTDAVQGIVMVVAVVVVLLAVIDAGGGMTQCIATLKAIDPGLITPTGPGDAV
PQPFMLSFWVLVGLGVLGLPQTTQRCMGYRDSRAMHDAMIIGTLLIGFMILCAHLAGTLG
RAVLPDLPAGDLAMPSLIVQLLSPFWAGVFIAGPLAAIMSTVDSMLLLASAAIVKDLYVR
YRLGGDTSRLRPVTMKRMSVASTAVIGVLVFVAAMEPPDLLVWINLFAFGGLEAVFLWPL
VLGLYWRRGNATGAIASILSGVTAFVWLTIAKPDMGGIHAIVPTTLLSLVMFVAGSLAGR
PSGREVDALFGGERS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory