Comparing 209035 MicrobesOnline__882:209035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
66% identity, 98% coverage: 4:243/244 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
66% identity, 98% coverage: 4:243/244 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
66% identity, 98% coverage: 4:243/244 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
66% identity, 98% coverage: 4:243/244 of query aligns to 3:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
64% identity, 99% coverage: 3:244/244 of query aligns to 1:241/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
64% identity, 98% coverage: 4:243/244 of query aligns to 1:240/240 of 4ymuJ
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
54% identity, 96% coverage: 5:239/244 of query aligns to 7:253/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
54% identity, 96% coverage: 5:239/244 of query aligns to 3:249/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 99% coverage: 4:244/244 of query aligns to 1:246/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
40% identity, 99% coverage: 4:244/244 of query aligns to 2:247/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
40% identity, 99% coverage: 4:244/244 of query aligns to 2:247/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
40% identity, 99% coverage: 4:244/244 of query aligns to 2:247/344 of 6cvlD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 1:242/244 of query aligns to 14:251/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 98% coverage: 1:240/244 of query aligns to 1:244/375 of 2d62A
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
36% identity, 96% coverage: 5:239/244 of query aligns to 11:252/257 of P0AAH0
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
39% identity, 97% coverage: 5:241/244 of query aligns to 4:236/369 of P19566
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 89% coverage: 24:239/244 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
39% identity, 89% coverage: 24:239/244 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 89% coverage: 4:220/244 of query aligns to 1:226/232 of 1f3oA
1g291 Malk (see paper)
36% identity, 97% coverage: 5:240/244 of query aligns to 4:241/372 of 1g291
Sites not aligning to the query:
>209035 MicrobesOnline__882:209035
MTPMIEIRNLHKSYGDHHVLRGIDLTVRTGEVVVVIGPSGSGKSTALRCINRLEEITSGT
IIVDGYDLYDPKTDINHVRTEAGMVFQQFNLFPHMSVLENVTIGPVKVRRMARQEAQALG
LALLEKVGLADKAHAYPDQLSGGQKQRVAIARSLAMQPKVLLFDEPTSALDPELVGEVLE
VMKQLAREGMTMVVVTHEMGFAREVADRVIFIDYGKIQEEGPPNELFADPKNPRLREFLG
KVIH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory