Comparing 209037 MicrobesOnline__882:209037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
54% identity, 90% coverage: 24:247/249 of query aligns to 3:226/226 of 8eyzA
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
46% identity, 88% coverage: 26:243/249 of query aligns to 6:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
46% identity, 88% coverage: 26:243/249 of query aligns to 6:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
44% identity, 87% coverage: 26:242/249 of query aligns to 12:228/229 of 5t0wA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 91% coverage: 21:247/249 of query aligns to 2:229/235 of 2pvuA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 91% coverage: 21:247/249 of query aligns to 8:235/241 of 2q2aA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 90% coverage: 24:247/249 of query aligns to 1:225/231 of 2q2cA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
38% identity, 88% coverage: 24:242/249 of query aligns to 14:234/235 of 4g4pA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
38% identity, 88% coverage: 26:243/249 of query aligns to 12:228/229 of 6svfA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
34% identity, 90% coverage: 19:242/249 of query aligns to 1:226/230 of 4kqpA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
36% identity, 87% coverage: 26:242/249 of query aligns to 3:222/224 of 4ymxA
2pyyB Crystal structure of the glur0 ligand-binding core from nostoc punctiforme in complex with (l)-glutamate (see paper)
36% identity, 79% coverage: 47:242/249 of query aligns to 18:210/217 of 2pyyB
Sites not aligning to the query:
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
34% identity, 88% coverage: 20:237/249 of query aligns to 12:231/239 of 4zefA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
34% identity, 93% coverage: 17:248/249 of query aligns to 1:237/237 of 4i62A
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
34% identity, 88% coverage: 25:242/249 of query aligns to 5:226/234 of 3k4uE
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
36% identity, 81% coverage: 48:249/249 of query aligns to 38:241/243 of 5eyfB
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
32% identity, 86% coverage: 28:241/249 of query aligns to 4:219/223 of 8b5dA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
30% identity, 88% coverage: 25:243/249 of query aligns to 14:231/237 of 3vv5A
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
31% identity, 86% coverage: 28:241/249 of query aligns to 6:221/225 of 8b5eA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
31% identity, 86% coverage: 28:241/249 of query aligns to 7:222/226 of 6fxgB
>209037 MicrobesOnline__882:209037
MKRLVKLVLGLALVLGLAATASAKQLVVAHDTNFKPFEFKGEDGKYTGFDIELWQAIAKI
AGVDYKLQPMDFNGIIPGLQTGNVDVGIAGITIKPERAAVVDFSDPYYDSGLMILVRENE
TGIKAVEDLAGKIVAVKTATSSVDFMKSFGKAKELKLFPNNDSMFFELMAGGADAVIFDM
PVVKEFAMTAGKGKVKVVGPLYQGQSYGIGFPKGSELVGKVNDALKQLKADGSYDKLFVK
WFGYAPEKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory