SitesBLAST
Comparing 209294 MicrobesOnline__882:209294 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6lpiB Crystal structure of ahas holo-enzyme (see paper)
60% identity, 98% coverage: 3:553/563 of query aligns to 5:539/539 of 6lpiB
- active site: I27 (= I25), G29 (= G27), G30 (= G28), S31 (≠ A29), I32 (≠ N30), E53 (= E51), C76 (≠ T74), F115 (= F113), Q116 (= Q114), E117 (= E115), K165 (= K163), M256 (= M256), A283 (= A283), V375 (= V384), G401 (= G410), M403 (= M412), D428 (= D437), N455 (= N464), A457 (= A466), L458 (= L467), L460 (= L469), V461 (= V470), Q464 (= Q473)
- binding flavin-adenine dinucleotide: R155 (= R153), G212 (= G210), G213 (= G211), G214 (= G212), T236 (≠ S236), L237 (= L237), M238 (≠ L238), L254 (= L254), M256 (= M256), H257 (= H257), G276 (= G276), A277 (= A277), R278 (= R278), D280 (= D280), R282 (= R282), A283 (= A283), D300 (= D300), I301 (= I301), D319 (= D319), V320 (≠ A320), M380 (= M389), G398 (= G407)
- binding magnesium ion: D428 (= D437), N455 (= N464)
- binding thiamine diphosphate: E53 (= E51), C76 (≠ T74), P79 (= P77), G376 (= G385), Q377 (= Q386), H378 (= H387), G401 (= G410), M403 (= M412), G427 (= G436), D428 (= D437), G429 (= G438), S430 (= S439), M433 (= M442), N455 (= N464), A457 (= A466), L458 (= L467), G459 (= G468), L460 (= L469), V461 (= V470)
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
44% identity, 98% coverage: 5:553/563 of query aligns to 98:661/670 of P17597
- A122 (= A29) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ L31) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E51) binding
- S186 (= S93) binding
- P197 (= P104) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ S106) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q114) binding
- K220 (= K127) binding
- R246 (= R153) binding ; binding
- K256 (= K163) binding
- G308 (= G211) binding
- TL 331:332 (≠ SL 236:237) binding
- C340 (≠ P245) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (= LGMH 254:257) binding
- GVRFD 371:375 (≠ GARFD 276:280) binding
- DR 376:377 (= DR 281:282) binding
- DI 395:396 (= DI 300:301) binding
- DV 414:415 (≠ DA 319:320) binding
- QH 487:488 (= QH 386:387) binding
- GG 508:509 (= GG 407:408) binding
- GAM 511:513 (≠ GTM 410:412) binding
- D538 (= D437) binding
- DGS 538:540 (= DGS 437:439) binding
- N565 (= N464) binding
- NQHLGM 565:570 (≠ NNALGL 464:469) binding
- H567 (≠ A466) binding
- W574 (≠ Q473) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
- S653 (≠ P545) binding ; mutation to A: No effect on catalytic activity or sensitivity to herbicides.; mutation to F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; mutation to N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; mutation to T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/585 of 5k2oA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (= M256), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), Q404 (= Q388), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
3ea4A Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron-ester (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 12:575/582 of 3ea4A
- active site: Y32 (≠ I25), G34 (= G27), G35 (= G28), A36 (= A29), S37 (≠ N30), E58 (= E51), T81 (= T74), F120 (= F113), Q121 (= Q114), E122 (= E115), K170 (= K163), M265 (= M256), V292 (≠ A283), V399 (= V384), G425 (= G410), M427 (= M412), D452 (= D437), N479 (= N464), H481 (≠ A466), L482 (= L467), M484 (≠ L469), V485 (= V470), W488 (≠ Q473), H557 (≠ V535)
- binding methyl 2-{[(4-methylpyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: D290 (= D281), R291 (= R282), W488 (≠ Q473), S567 (≠ P545)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G210), G222 (= G211), G223 (= G212), T245 (≠ S236), L246 (= L237), M247 (≠ L238), L263 (= L254), G264 (= G255), M265 (= M256), H266 (= H257), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ A320), M404 (= M389), G422 (= G407)
- binding magnesium ion: D452 (= D437), N479 (= N464), H481 (≠ A466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V384), G400 (= G385), Q401 (= Q386), H402 (= H387), M427 (= M412), G451 (= G436), D452 (= D437), G453 (= G438), S454 (= S439), N479 (= N464), H481 (≠ A466), L482 (= L467), G483 (= G468), M484 (≠ L469), V485 (= V470)
3e9yA Arabidopsis thaliana acetohydroxyacid synthase in complex with monosulfuron (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 12:575/582 of 3e9yA
- active site: Y32 (≠ I25), G34 (= G27), G35 (= G28), A36 (= A29), S37 (≠ N30), E58 (= E51), T81 (= T74), F120 (= F113), Q121 (= Q114), E122 (= E115), K170 (= K163), M265 (= M256), V292 (≠ A283), V399 (= V384), G425 (= G410), M427 (= M412), D452 (= D437), N479 (= N464), H481 (≠ A466), L482 (= L467), M484 (≠ L469), V485 (= V470), W488 (≠ Q473), H557 (≠ V535)
- binding N-[(4-methylpyrimidin-2-yl)carbamoyl]-2-nitrobenzenesulfonamide: D290 (= D281), R291 (= R282), W488 (≠ Q473), S567 (≠ P545)
- binding flavin-adenine dinucleotide-n5-isobutyl ketone: R160 (= R153), G221 (= G210), G222 (= G211), G223 (= G212), T245 (≠ S236), L246 (= L237), M247 (≠ L238), L263 (= L254), G285 (= G276), R287 (= R278), D289 (= D280), R291 (= R282), D309 (= D300), I310 (= I301), G327 (= G318), D328 (= D319), V329 (≠ A320), M404 (= M389), G422 (= G407)
- binding magnesium ion: D452 (= D437), N479 (= N464), H481 (≠ A466)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V399 (= V384), G400 (= G385), Q401 (= Q386), H402 (= H387), M427 (= M412), G451 (= G436), G453 (= G438), S454 (= S439), N479 (= N464), H481 (≠ A466), L482 (= L467), G483 (= G468), M484 (≠ L469), V485 (= V470)
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407)
- binding magnesium ion: F370 (≠ T354), D453 (= D437), M458 (= M442), Q461 (= Q445), N480 (= N464), H482 (≠ A466), K533 (≠ S510)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (= M256), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 5wj1A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), M263 (= M253), L264 (= L254), G286 (= G276), R288 (= R278), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (= M256), D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 5k6tA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (= H257), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), G286 (= G276), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), Q404 (= Q388), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468)
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 5k6rA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), M458 (= M442), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1z8nA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (= K127), R161 (= R153), Y191 (vs. gap), R194 (≠ G179), D291 (= D281), R292 (= R282), D312 (= D302), W489 (≠ Q473), G569 (= G546)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464)
- binding thiamine diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
1yi1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1yi1A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: D291 (= D281), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), M263 (= M253), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
1yi0A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1yi0A
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), D310 (= D300), I311 (= I301), G328 (= G318), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
1yhzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1yhzA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
1yhyA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1yhyA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D291 (= D281), R292 (= R282), V486 (= V470), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
1ybhA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylurea herbicide chlorimuron ethyl (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 1ybhA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: M266 (= M256), D291 (= D281), R292 (= R282), M485 (≠ L469), W489 (≠ Q473), S568 (≠ P545)
- binding flavin-adenine dinucleotide: R161 (= R153), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), V287 (≠ A277), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), Q404 (= Q388), M405 (= M389), G423 (= G407), G424 (= G408)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 13:576/583 of 5k3sA
- active site: Y33 (≠ I25), G35 (= G27), G36 (= G28), A37 (= A29), S38 (≠ N30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M266 (= M256), V293 (≠ A283), V400 (= V384), G426 (= G410), M428 (= M412), D453 (= D437), N480 (= N464), H482 (≠ A466), L483 (= L467), M485 (≠ L469), V486 (= V470), W489 (≠ Q473), H558 (≠ V535)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (= R282), M485 (≠ L469), W489 (≠ Q473), G569 (= G546)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), L264 (= L254), M266 (= M256), G286 (= G276), R288 (= R278), D290 (= D280), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407)
- binding magnesium ion: D453 (= D437), N480 (= N464), H482 (≠ A466)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), D453 (= D437), G454 (= G438), S455 (= S439), N480 (= N464), H482 (≠ A466), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
7tzzA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase p197t mutant in complex with bispyribac-sodium (see paper)
43% identity, 98% coverage: 5:553/563 of query aligns to 13:576/582 of 7tzzA
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: M266 (= M256), R292 (= R282), W489 (≠ Q473), S568 (≠ P545)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (= V384), G401 (= G385), Q402 (= Q386), H403 (= H387), G426 (= G410), M428 (= M412), G452 (= G436), D453 (= D437), G454 (= G438), S455 (= S439), L483 (= L467), G484 (= G468), M485 (≠ L469), V486 (= V470)
- binding flavin-adenine dinucleotide: R161 (= R153), G222 (= G210), G223 (= G211), G224 (= G212), T246 (≠ S236), L247 (= L237), M248 (≠ L238), M263 (= M253), L264 (= L254), M266 (= M256), H267 (= H257), G286 (= G276), R288 (= R278), V293 (≠ A283), D310 (= D300), I311 (= I301), D329 (= D319), V330 (≠ A320), M405 (= M389), G423 (= G407)
- binding magnesium ion: A37 (= A29), T82 (= T74), S83 (= S75), Q122 (= Q114), Y381 (≠ G365), D453 (= D437), M458 (= M442), Q461 (= Q445), N480 (= N464), H482 (≠ A466), K533 (≠ S510)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
43% identity, 98% coverage: 5:553/563 of query aligns to 95:658/667 of P09342
- C161 (≠ F71) modified: Disulfide link with 307
- P194 (= P104) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A215) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
44% identity, 98% coverage: 5:553/563 of query aligns to 92:655/664 of P09114
- P191 (= P104) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (≠ Q473) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
40% identity, 98% coverage: 4:553/563 of query aligns to 10:577/599 of 1n0hA
- active site: Y31 (≠ I25), G33 (= G27), G34 (= G28), A35 (= A29), I36 (≠ N30), E57 (= E51), T80 (= T74), F119 (= F113), Q120 (= Q114), E121 (= E115), K169 (= K163), R230 (≠ E220), M266 (= M256), V293 (≠ A283), V409 (= V384), L434 (= L409), G435 (= G410), M437 (= M412), D462 (= D437), N489 (= N464), E491 (≠ A466), Q492 (≠ L467), M494 (≠ L469), V495 (= V470), W498 (≠ Q473), L520 (≠ I496), G525 (= G501), L526 (≠ V502), K559 (≠ V535)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V384), G410 (= G385), Q411 (= Q386), H412 (= H387), G435 (= G410), M437 (= M412), G461 (= G436), D462 (= D437), A463 (≠ G438), S464 (= S439), M467 (= M442), N489 (= N464), E491 (≠ A466), Q492 (≠ L467), G493 (= G468), V495 (= V470)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G28), A35 (= A29), V109 (= V103), P110 (= P104), F119 (= F113), K169 (= K163), M266 (= M256), D291 (= D281), R292 (= R282), V495 (= V470), W498 (≠ Q473)
- binding flavin-adenine dinucleotide: R159 (= R153), G219 (= G210), A220 (≠ G211), G221 (= G212), N224 (≠ A215), T246 (≠ S236), L247 (= L237), Q248 (≠ L238), L264 (= L254), G265 (= G255), M266 (= M256), H267 (= H257), G286 (= G276), A287 (= A277), R288 (= R278), D290 (= D280), R292 (= R282), V293 (≠ A283), E319 (≠ D300), V320 (≠ I301), N324 (≠ E305), G337 (= G318), D338 (= D319), A339 (= A320), M414 (= M389), G432 (= G407), G433 (= G408)
- binding magnesium ion: D462 (= D437), N489 (= N464), E491 (≠ A466)
- binding thiamine diphosphate: Y31 (≠ I25), E57 (= E51), P83 (= P77)
Query Sequence
>209294 MicrobesOnline__882:209294
MYRMSGAELVIRLLERQGIDCISGIPGGANLPLYDALSHSKRIRHVLARHEQGAGFIAQG
MARSTGRPAVFFATSGPGATNTLTAIADAKLDSVPVICITGQVPRSMIGSDAFQEVDIYG
MSIPVTKHNFLVRSVEDLLTVIPEAFRIATSGRPGPVLVDIPKDVQTAEVAFEAWPETGG
PDPAEAPDMEGLARAARMLAEAERPILFIGGGVVASGAGEVARVFAERTGLPTAMSLLGL
GTLPPEHPLTLGMLGMHGARCTNMLLEECDLLMVVGARFDDRATGRIEQFCPHASIIHVD
IDPSEIDKLRTAHVAITGDAGRVLEALLPMLEPVDRKAWHGHVARMKAAHPLLTPGADDP
RTPYGLVTCTAACLDDSAIIATDVGQHQMRTAQAYPLRRTRQWLTSGGLGTMGFGLPAAI
GAALANPERTVVCFTGDGSLQMNIQELATAAETGANVKIVLANNNALGLVQQQQDLFYGR
RIFASDFTHRIDFVRIAEGFGVPAVDLGRSADPKRDLARALRAKGPCLIHVPVAVEENVY
PMVPPGAANTEMIGGEAHAPAHA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory